Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1804717..1804933 | Replicon | chromosome |
Accession | NZ_CP062336 | ||
Organism | Staphylococcus aureus strain NAS_NP_161 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | IF748_RS08945 | Protein ID | WP_001802298.1 |
Coordinates | 1804829..1804933 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1804717..1804772 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF748_RS08920 | 1799753..1800073 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
IF748_RS08925 | 1800075..1801055 | + | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
IF748_RS08930 | 1801321..1802412 | + | 1092 | WP_000495672.1 | hypothetical protein | - |
IF748_RS08935 | 1802441..1804087 | - | 1647 | WP_000277718.1 | IS1182 family transposase | - |
- | 1804717..1804772 | + | 56 | - | - | Antitoxin |
IF748_RS08945 | 1804829..1804933 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
IF748_RS08950 | 1805613..1805771 | + | 159 | WP_001792784.1 | hypothetical protein | - |
IF748_RS08955 | 1806430..1807287 | - | 858 | WP_240029689.1 | HAD family hydrolase | - |
IF748_RS08960 | 1807355..1808137 | - | 783 | WP_000908174.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1802441..1804087 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T174380 WP_001802298.1 NZ_CP062336:c1804933-1804829 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T174380 NZ_CP062336:c1804933-1804829 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT174380 NZ_CP062336:1804717-1804772 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|