Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1265158..1265380 Replicon chromosome
Accession NZ_CP062245
Organism Escherichia coli strain AML003_ev01

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag IHN50_RS06185 Protein ID WP_000170963.1
Coordinates 1265158..1265265 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1265313..1265380 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHN50_RS06155 1260467..1261549 + 1083 WP_000804726.1 peptide chain release factor 1 -
IHN50_RS06160 1261549..1262382 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
IHN50_RS06165 1262379..1262771 + 393 WP_000200374.1 invasion regulator SirB2 -
IHN50_RS06170 1262775..1263584 + 810 WP_001257044.1 invasion regulator SirB1 -
IHN50_RS06175 1263620..1264474 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IHN50_RS06180 1264623..1264730 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1264778..1264844 + 67 NuclAT_34 - -
- 1264778..1264844 + 67 NuclAT_34 - -
- 1264778..1264844 + 67 NuclAT_34 - -
- 1264778..1264844 + 67 NuclAT_34 - -
- 1264778..1264844 + 67 NuclAT_36 - -
- 1264778..1264844 + 67 NuclAT_36 - -
- 1264778..1264844 + 67 NuclAT_36 - -
- 1264778..1264844 + 67 NuclAT_36 - -
- 1264778..1264844 + 67 NuclAT_38 - -
- 1264778..1264844 + 67 NuclAT_38 - -
- 1264778..1264844 + 67 NuclAT_38 - -
- 1264778..1264844 + 67 NuclAT_38 - -
- 1264778..1264844 + 67 NuclAT_40 - -
- 1264778..1264844 + 67 NuclAT_40 - -
- 1264778..1264844 + 67 NuclAT_40 - -
- 1264778..1264844 + 67 NuclAT_40 - -
- 1264778..1264844 + 67 NuclAT_42 - -
- 1264778..1264844 + 67 NuclAT_42 - -
- 1264778..1264844 + 67 NuclAT_42 - -
- 1264778..1264844 + 67 NuclAT_42 - -
- 1264778..1264844 + 67 NuclAT_44 - -
- 1264778..1264844 + 67 NuclAT_44 - -
- 1264778..1264844 + 67 NuclAT_44 - -
- 1264778..1264844 + 67 NuclAT_44 - -
- 1264780..1264845 + 66 NuclAT_18 - -
- 1264780..1264845 + 66 NuclAT_18 - -
- 1264780..1264845 + 66 NuclAT_18 - -
- 1264780..1264845 + 66 NuclAT_18 - -
- 1264780..1264845 + 66 NuclAT_21 - -
- 1264780..1264845 + 66 NuclAT_21 - -
- 1264780..1264845 + 66 NuclAT_21 - -
- 1264780..1264845 + 66 NuclAT_21 - -
- 1264780..1264845 + 66 NuclAT_24 - -
- 1264780..1264845 + 66 NuclAT_24 - -
- 1264780..1264845 + 66 NuclAT_24 - -
- 1264780..1264845 + 66 NuclAT_24 - -
- 1264780..1264845 + 66 NuclAT_27 - -
- 1264780..1264845 + 66 NuclAT_27 - -
- 1264780..1264845 + 66 NuclAT_27 - -
- 1264780..1264845 + 66 NuclAT_27 - -
- 1264780..1264845 + 66 NuclAT_30 - -
- 1264780..1264845 + 66 NuclAT_30 - -
- 1264780..1264845 + 66 NuclAT_30 - -
- 1264780..1264845 + 66 NuclAT_30 - -
- 1264780..1264845 + 66 NuclAT_33 - -
- 1264780..1264845 + 66 NuclAT_33 - -
- 1264780..1264845 + 66 NuclAT_33 - -
- 1264780..1264845 + 66 NuclAT_33 - -
IHN50_RS06185 1265158..1265265 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1265313..1265380 + 68 NuclAT_17 - Antitoxin
- 1265313..1265380 + 68 NuclAT_17 - Antitoxin
- 1265313..1265380 + 68 NuclAT_17 - Antitoxin
- 1265313..1265380 + 68 NuclAT_17 - Antitoxin
- 1265313..1265380 + 68 NuclAT_20 - Antitoxin
- 1265313..1265380 + 68 NuclAT_20 - Antitoxin
- 1265313..1265380 + 68 NuclAT_20 - Antitoxin
- 1265313..1265380 + 68 NuclAT_20 - Antitoxin
- 1265313..1265380 + 68 NuclAT_23 - Antitoxin
- 1265313..1265380 + 68 NuclAT_23 - Antitoxin
- 1265313..1265380 + 68 NuclAT_23 - Antitoxin
- 1265313..1265380 + 68 NuclAT_23 - Antitoxin
- 1265313..1265380 + 68 NuclAT_26 - Antitoxin
- 1265313..1265380 + 68 NuclAT_26 - Antitoxin
- 1265313..1265380 + 68 NuclAT_26 - Antitoxin
- 1265313..1265380 + 68 NuclAT_26 - Antitoxin
- 1265313..1265380 + 68 NuclAT_29 - Antitoxin
- 1265313..1265380 + 68 NuclAT_29 - Antitoxin
- 1265313..1265380 + 68 NuclAT_29 - Antitoxin
- 1265313..1265380 + 68 NuclAT_29 - Antitoxin
- 1265313..1265380 + 68 NuclAT_32 - Antitoxin
- 1265313..1265380 + 68 NuclAT_32 - Antitoxin
- 1265313..1265380 + 68 NuclAT_32 - Antitoxin
- 1265313..1265380 + 68 NuclAT_32 - Antitoxin
- 1265314..1265379 + 66 NuclAT_35 - -
- 1265314..1265379 + 66 NuclAT_35 - -
- 1265314..1265379 + 66 NuclAT_35 - -
- 1265314..1265379 + 66 NuclAT_35 - -
- 1265314..1265379 + 66 NuclAT_37 - -
- 1265314..1265379 + 66 NuclAT_37 - -
- 1265314..1265379 + 66 NuclAT_37 - -
- 1265314..1265379 + 66 NuclAT_37 - -
- 1265314..1265379 + 66 NuclAT_39 - -
- 1265314..1265379 + 66 NuclAT_39 - -
- 1265314..1265379 + 66 NuclAT_39 - -
- 1265314..1265379 + 66 NuclAT_39 - -
- 1265314..1265379 + 66 NuclAT_41 - -
- 1265314..1265379 + 66 NuclAT_41 - -
- 1265314..1265379 + 66 NuclAT_41 - -
- 1265314..1265379 + 66 NuclAT_41 - -
- 1265314..1265379 + 66 NuclAT_43 - -
- 1265314..1265379 + 66 NuclAT_43 - -
- 1265314..1265379 + 66 NuclAT_43 - -
- 1265314..1265379 + 66 NuclAT_43 - -
- 1265314..1265379 + 66 NuclAT_45 - -
- 1265314..1265379 + 66 NuclAT_45 - -
- 1265314..1265379 + 66 NuclAT_45 - -
- 1265314..1265379 + 66 NuclAT_45 - -
IHN50_RS06190 1265693..1265800 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1265848..1265915 + 68 NuclAT_16 - -
- 1265848..1265915 + 68 NuclAT_16 - -
- 1265848..1265915 + 68 NuclAT_16 - -
- 1265848..1265915 + 68 NuclAT_16 - -
- 1265848..1265915 + 68 NuclAT_19 - -
- 1265848..1265915 + 68 NuclAT_19 - -
- 1265848..1265915 + 68 NuclAT_19 - -
- 1265848..1265915 + 68 NuclAT_19 - -
- 1265848..1265915 + 68 NuclAT_22 - -
- 1265848..1265915 + 68 NuclAT_22 - -
- 1265848..1265915 + 68 NuclAT_22 - -
- 1265848..1265915 + 68 NuclAT_22 - -
- 1265848..1265915 + 68 NuclAT_25 - -
- 1265848..1265915 + 68 NuclAT_25 - -
- 1265848..1265915 + 68 NuclAT_25 - -
- 1265848..1265915 + 68 NuclAT_25 - -
- 1265848..1265915 + 68 NuclAT_28 - -
- 1265848..1265915 + 68 NuclAT_28 - -
- 1265848..1265915 + 68 NuclAT_28 - -
- 1265848..1265915 + 68 NuclAT_28 - -
- 1265848..1265915 + 68 NuclAT_31 - -
- 1265848..1265915 + 68 NuclAT_31 - -
- 1265848..1265915 + 68 NuclAT_31 - -
- 1265848..1265915 + 68 NuclAT_31 - -
IHN50_RS06195 1266204..1267304 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
IHN50_RS06200 1267574..1267804 + 231 WP_001146444.1 putative cation transport regulator ChaB -
IHN50_RS06205 1267962..1268657 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
IHN50_RS06210 1268701..1269054 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T173892 WP_000170963.1 NZ_CP062245:c1265265-1265158 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T173892 NZ_CP080370:1843455-1843709 [Escherichia coli]
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA

Antitoxin


Download         Length: 68 bp

>AT173892 NZ_CP062245:1265313-1265380 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References