Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2005060..2005281 Replicon chromosome
Accession NZ_CP062211
Organism Escherichia coli strain L3Cip3

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag IFO96_RS09690 Protein ID WP_000170954.1
Coordinates 2005060..2005167 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2005215..2005281 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IFO96_RS09665 2000904..2001986 + 1083 WP_000804726.1 peptide chain release factor 1 -
IFO96_RS09670 2001986..2002819 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
IFO96_RS09675 2002816..2003208 + 393 WP_000200378.1 invasion regulator SirB2 -
IFO96_RS09680 2003212..2004021 + 810 WP_001257044.1 invasion regulator SirB1 -
IFO96_RS09685 2004057..2004911 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IFO96_RS09690 2005060..2005167 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2005215..2005281 + 67 NuclAT_26 - Antitoxin
- 2005215..2005281 + 67 NuclAT_26 - Antitoxin
- 2005215..2005281 + 67 NuclAT_26 - Antitoxin
- 2005215..2005281 + 67 NuclAT_26 - Antitoxin
- 2005215..2005281 + 67 NuclAT_28 - Antitoxin
- 2005215..2005281 + 67 NuclAT_28 - Antitoxin
- 2005215..2005281 + 67 NuclAT_28 - Antitoxin
- 2005215..2005281 + 67 NuclAT_28 - Antitoxin
- 2005215..2005281 + 67 NuclAT_30 - Antitoxin
- 2005215..2005281 + 67 NuclAT_30 - Antitoxin
- 2005215..2005281 + 67 NuclAT_30 - Antitoxin
- 2005215..2005281 + 67 NuclAT_30 - Antitoxin
- 2005215..2005281 + 67 NuclAT_32 - Antitoxin
- 2005215..2005281 + 67 NuclAT_32 - Antitoxin
- 2005215..2005281 + 67 NuclAT_32 - Antitoxin
- 2005215..2005281 + 67 NuclAT_32 - Antitoxin
- 2005215..2005281 + 67 NuclAT_34 - Antitoxin
- 2005215..2005281 + 67 NuclAT_34 - Antitoxin
- 2005215..2005281 + 67 NuclAT_34 - Antitoxin
- 2005215..2005281 + 67 NuclAT_34 - Antitoxin
- 2005215..2005281 + 67 NuclAT_36 - Antitoxin
- 2005215..2005281 + 67 NuclAT_36 - Antitoxin
- 2005215..2005281 + 67 NuclAT_36 - Antitoxin
- 2005215..2005281 + 67 NuclAT_36 - Antitoxin
- 2005217..2005280 + 64 NuclAT_39 - -
- 2005217..2005280 + 64 NuclAT_39 - -
- 2005217..2005280 + 64 NuclAT_39 - -
- 2005217..2005280 + 64 NuclAT_39 - -
- 2005217..2005280 + 64 NuclAT_41 - -
- 2005217..2005280 + 64 NuclAT_41 - -
- 2005217..2005280 + 64 NuclAT_41 - -
- 2005217..2005280 + 64 NuclAT_41 - -
- 2005217..2005280 + 64 NuclAT_43 - -
- 2005217..2005280 + 64 NuclAT_43 - -
- 2005217..2005280 + 64 NuclAT_43 - -
- 2005217..2005280 + 64 NuclAT_43 - -
IFO96_RS09695 2005595..2005702 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2005755..2005816 + 62 NuclAT_38 - -
- 2005755..2005816 + 62 NuclAT_38 - -
- 2005755..2005816 + 62 NuclAT_38 - -
- 2005755..2005816 + 62 NuclAT_38 - -
- 2005755..2005816 + 62 NuclAT_40 - -
- 2005755..2005816 + 62 NuclAT_40 - -
- 2005755..2005816 + 62 NuclAT_40 - -
- 2005755..2005816 + 62 NuclAT_40 - -
- 2005755..2005816 + 62 NuclAT_42 - -
- 2005755..2005816 + 62 NuclAT_42 - -
- 2005755..2005816 + 62 NuclAT_42 - -
- 2005755..2005816 + 62 NuclAT_42 - -
- 2005755..2005817 + 63 NuclAT_27 - -
- 2005755..2005817 + 63 NuclAT_27 - -
- 2005755..2005817 + 63 NuclAT_27 - -
- 2005755..2005817 + 63 NuclAT_27 - -
- 2005755..2005817 + 63 NuclAT_29 - -
- 2005755..2005817 + 63 NuclAT_29 - -
- 2005755..2005817 + 63 NuclAT_29 - -
- 2005755..2005817 + 63 NuclAT_29 - -
- 2005755..2005817 + 63 NuclAT_31 - -
- 2005755..2005817 + 63 NuclAT_31 - -
- 2005755..2005817 + 63 NuclAT_31 - -
- 2005755..2005817 + 63 NuclAT_31 - -
- 2005755..2005817 + 63 NuclAT_33 - -
- 2005755..2005817 + 63 NuclAT_33 - -
- 2005755..2005817 + 63 NuclAT_33 - -
- 2005755..2005817 + 63 NuclAT_33 - -
- 2005755..2005817 + 63 NuclAT_35 - -
- 2005755..2005817 + 63 NuclAT_35 - -
- 2005755..2005817 + 63 NuclAT_35 - -
- 2005755..2005817 + 63 NuclAT_35 - -
- 2005755..2005817 + 63 NuclAT_37 - -
- 2005755..2005817 + 63 NuclAT_37 - -
- 2005755..2005817 + 63 NuclAT_37 - -
- 2005755..2005817 + 63 NuclAT_37 - -
- 2005755..2005818 + 64 NuclAT_15 - -
- 2005755..2005818 + 64 NuclAT_15 - -
- 2005755..2005818 + 64 NuclAT_15 - -
- 2005755..2005818 + 64 NuclAT_15 - -
- 2005755..2005818 + 64 NuclAT_17 - -
- 2005755..2005818 + 64 NuclAT_17 - -
- 2005755..2005818 + 64 NuclAT_17 - -
- 2005755..2005818 + 64 NuclAT_17 - -
- 2005755..2005818 + 64 NuclAT_19 - -
- 2005755..2005818 + 64 NuclAT_19 - -
- 2005755..2005818 + 64 NuclAT_19 - -
- 2005755..2005818 + 64 NuclAT_19 - -
- 2005755..2005818 + 64 NuclAT_21 - -
- 2005755..2005818 + 64 NuclAT_21 - -
- 2005755..2005818 + 64 NuclAT_21 - -
- 2005755..2005818 + 64 NuclAT_21 - -
- 2005755..2005818 + 64 NuclAT_23 - -
- 2005755..2005818 + 64 NuclAT_23 - -
- 2005755..2005818 + 64 NuclAT_23 - -
- 2005755..2005818 + 64 NuclAT_23 - -
- 2005755..2005818 + 64 NuclAT_25 - -
- 2005755..2005818 + 64 NuclAT_25 - -
- 2005755..2005818 + 64 NuclAT_25 - -
- 2005755..2005818 + 64 NuclAT_25 - -
IFO96_RS09700 2006131..2006238 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2006286..2006353 + 68 NuclAT_14 - -
- 2006286..2006353 + 68 NuclAT_14 - -
- 2006286..2006353 + 68 NuclAT_14 - -
- 2006286..2006353 + 68 NuclAT_14 - -
- 2006286..2006353 + 68 NuclAT_16 - -
- 2006286..2006353 + 68 NuclAT_16 - -
- 2006286..2006353 + 68 NuclAT_16 - -
- 2006286..2006353 + 68 NuclAT_16 - -
- 2006286..2006353 + 68 NuclAT_18 - -
- 2006286..2006353 + 68 NuclAT_18 - -
- 2006286..2006353 + 68 NuclAT_18 - -
- 2006286..2006353 + 68 NuclAT_18 - -
- 2006286..2006353 + 68 NuclAT_20 - -
- 2006286..2006353 + 68 NuclAT_20 - -
- 2006286..2006353 + 68 NuclAT_20 - -
- 2006286..2006353 + 68 NuclAT_20 - -
- 2006286..2006353 + 68 NuclAT_22 - -
- 2006286..2006353 + 68 NuclAT_22 - -
- 2006286..2006353 + 68 NuclAT_22 - -
- 2006286..2006353 + 68 NuclAT_22 - -
- 2006286..2006353 + 68 NuclAT_24 - -
- 2006286..2006353 + 68 NuclAT_24 - -
- 2006286..2006353 + 68 NuclAT_24 - -
- 2006286..2006353 + 68 NuclAT_24 - -
IFO96_RS09705 2006643..2007743 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
IFO96_RS09710 2008013..2008243 + 231 WP_001146442.1 putative cation transport regulator ChaB -
IFO96_RS09715 2008401..2009096 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
IFO96_RS09720 2009140..2009493 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T173537 WP_000170954.1 NZ_CP062211:c2005167-2005060 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T173537 NZ_CP080240:27640-27927 [Vibrio sp. ED002]
ATGAAAGTAGTTTGGTCTCCATTAGCGCTTCAAAAGTTAGGCGATGCAGCGGAGTTCATTTCTTGGGATAATCCATCTGC
GGCAGAAAAGTGGGTAAACGAAGTTTTTGATAAAACTGAACTACTTGGAAGTATGCCTGAGATGGGGCGCTTTGTTCCTG
AAATGCCTCATACGAATTATCGTGAAATTATTTTTGGTCACTATCGTATTATCTACAGCTTAAGTCATGAAATCCGCGTA
CTAACAGTTCGTAATTGTCGTCAAATGTTGTCGGAAGATGATGTGTAA

Antitoxin


Download         Length: 67 bp

>AT173537 NZ_CP062211:2005215-2005281 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References