Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34947..35216 | Replicon | plasmid pM2901 |
| Accession | NZ_CP061363 | ||
| Organism | Shigella sonnei strain 6207 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | IC759_RS00260 | Protein ID | WP_001372321.1 |
| Coordinates | 35091..35216 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 34947..35012 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IC759_RS00225 | 30712..31239 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| IC759_RS00230 | 31297..31530 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| IC759_RS00235 | 31591..33559 | + | 1969 | Protein_46 | ParB/RepB/Spo0J family partition protein | - |
| IC759_RS00240 | 33628..34062 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| IC759_RS00245 | 34059..34778 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 34790..35014 | + | 225 | NuclAT_0 | - | - |
| - | 34790..35014 | + | 225 | NuclAT_0 | - | - |
| - | 34790..35014 | + | 225 | NuclAT_0 | - | - |
| - | 34790..35014 | + | 225 | NuclAT_0 | - | - |
| IC759_RS00250 | 34799..34978 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 34947..35012 | - | 66 | - | - | Antitoxin |
| IC759_RS00255 | 35000..35149 | + | 150 | Protein_50 | plasmid maintenance protein Mok | - |
| IC759_RS00260 | 35091..35216 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| IC759_RS00265 | 35535..35831 | - | 297 | Protein_52 | hypothetical protein | - |
| IC759_RS00270 | 36131..36427 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| IC759_RS00275 | 36538..37359 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| IC759_RS00280 | 37656..38258 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| IC759_RS00285 | 38581..38964 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| IC759_RS00290 | 39158..39829 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| IC759_RS00295 | 39966..40193 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T172471 WP_001372321.1 NZ_CP061363:35091-35216 [Shigella sonnei]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T172471 NZ_CP079767:3636425-3636532 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT172471 NZ_CP061363:c35012-34947 [Shigella sonnei]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|