Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1957295..1957516 | Replicon | chromosome |
Accession | NZ_CP061339 | ||
Organism | Escherichia coli strain M00057 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | IC755_RS09390 | Protein ID | WP_000170965.1 |
Coordinates | 1957295..1957402 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1957450..1957516 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IC755_RS09365 | 1953140..1954222 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
IC755_RS09370 | 1954222..1955055 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
IC755_RS09375 | 1955052..1955444 | + | 393 | WP_000151883.1 | invasion regulator SirB2 | - |
IC755_RS09380 | 1955448..1956257 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
IC755_RS09385 | 1956293..1957147 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
IC755_RS09390 | 1957295..1957402 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1957450..1957516 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_18 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_18 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_18 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_18 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_20 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_20 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_20 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_20 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_22 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_22 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_22 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_22 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_24 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_24 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_24 | - | Antitoxin |
- | 1957450..1957516 | + | 67 | NuclAT_24 | - | Antitoxin |
- | 1957452..1957515 | + | 64 | NuclAT_27 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_27 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_27 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_27 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_29 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_29 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_29 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_29 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_31 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_31 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_31 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_31 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_33 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_33 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_33 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_33 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_35 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_35 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_35 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_35 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_37 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_37 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_37 | - | - |
- | 1957452..1957515 | + | 64 | NuclAT_37 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_39 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_39 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_39 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_39 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_41 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_41 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_41 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_41 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_43 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_43 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_43 | - | - |
- | 1957452..1957517 | + | 66 | NuclAT_43 | - | - |
IC755_RS09395 | 1957830..1957937 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
- | 1957990..1958051 | + | 62 | NuclAT_26 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_26 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_26 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_26 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_28 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_28 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_28 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_28 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_30 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_30 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_30 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_30 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_32 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_32 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_32 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_32 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_34 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_34 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_34 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_34 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_36 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_36 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_36 | - | - |
- | 1957990..1958051 | + | 62 | NuclAT_36 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_15 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_15 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_15 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_15 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_17 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_17 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_17 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_17 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_19 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_19 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_19 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_19 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_21 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_21 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_21 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_21 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_23 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_23 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_23 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_23 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_25 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_25 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_25 | - | - |
- | 1957990..1958052 | + | 63 | NuclAT_25 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_38 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_38 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_38 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_38 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_40 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_40 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_40 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_40 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_42 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_42 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_42 | - | - |
- | 1957990..1958053 | + | 64 | NuclAT_42 | - | - |
IC755_RS09400 | 1958343..1959443 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
IC755_RS09405 | 1959713..1959943 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
IC755_RS09410 | 1960101..1960796 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
IC755_RS09415 | 1960840..1961193 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T172413 WP_000170965.1 NZ_CP061339:c1957402-1957295 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T172413 NZ_CP079752:907305-907715 [Raoultella ornithinolytica]
GTGGTCCTGTGGCAATCTGATTTACGCATCTCCTGGCGCTCACAGTGGTTCTCGCTGCTGCTGCACGGCATTGTGGCGGC
TATTGTGCTGCTGATGCCCTGGCCGCTGAGCTACACGCCGCTATGGCTATTGCTGCTGTCGCTGGTGGTGTTCGACAGCG
TGCGCAGCCAGCGGCGGATCCACGCCTGCCGGGGGGAAATAAAGCTGATGACCGATTCGCGTTTGCGTTGGCAAAAAGCG
GAATGGGAGATTGTCGGCACGCCGTGGGTGATTAATAGCGGGATGTTGCTGCGTCTGCAGGATATGCAAACGCGTCGCCG
CCAGCATCTGTGGATCGCTGCAGACAGTATGGACACCAAAGAGTGGCGAGATCTGCGCCGGTTGGTGTTACAAAAACCGG
CACAGGAGTAA
GTGGTCCTGTGGCAATCTGATTTACGCATCTCCTGGCGCTCACAGTGGTTCTCGCTGCTGCTGCACGGCATTGTGGCGGC
TATTGTGCTGCTGATGCCCTGGCCGCTGAGCTACACGCCGCTATGGCTATTGCTGCTGTCGCTGGTGGTGTTCGACAGCG
TGCGCAGCCAGCGGCGGATCCACGCCTGCCGGGGGGAAATAAAGCTGATGACCGATTCGCGTTTGCGTTGGCAAAAAGCG
GAATGGGAGATTGTCGGCACGCCGTGGGTGATTAATAGCGGGATGTTGCTGCGTCTGCAGGATATGCAAACGCGTCGCCG
CCAGCATCTGTGGATCGCTGCAGACAGTATGGACACCAAAGAGTGGCGAGATCTGCGCCGGTTGGTGTTACAAAAACCGG
CACAGGAGTAA
Antitoxin
Download Length: 67 bp
>AT172413 NZ_CP061339:1957450-1957516 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|