Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 333378..333969 | Replicon | chromosome |
Accession | NZ_CP061298 | ||
Organism | Polynucleobacter paludilacus strain MWH-Mekk-C3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | AOC06_RS01855 | Protein ID | WP_112203122.1 |
Coordinates | 333378..333656 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | AOC06_RS01860 | Protein ID | WP_215272412.1 |
Coordinates | 333664..333969 (+) | Length | 102 a.a. |
Genomic Context
Location: 329810..330172 (363 bp)
Type: Others
Protein ID: WP_215284471.1
Type: Others
Protein ID: WP_215284471.1
Location: 333378..333656 (279 bp)
Type: Toxin
Protein ID: WP_112203122.1
Type: Toxin
Protein ID: WP_112203122.1
Location: 333664..333969 (306 bp)
Type: Antitoxin
Protein ID: WP_215272412.1
Type: Antitoxin
Protein ID: WP_215272412.1
Location: 334020..334268 (249 bp)
Type: Others
Protein ID: WP_112203124.1
Type: Others
Protein ID: WP_112203124.1
Location: 335129..335722 (594 bp)
Type: Others
Protein ID: WP_112203130.1
Type: Others
Protein ID: WP_112203130.1
Location: 335765..335935 (171 bp)
Type: Others
Protein ID: WP_158525168.1
Type: Others
Protein ID: WP_158525168.1
Location: 336027..337094 (1068 bp)
Type: Others
Protein ID: WP_112294891.1
Type: Others
Protein ID: WP_112294891.1
Location: 328720..329739 (1020 bp)
Type: Others
Protein ID: WP_112294897.1
Type: Others
Protein ID: WP_112294897.1
Location: 330095..330907 (813 bp)
Type: Others
Protein ID: WP_215284657.1
Type: Others
Protein ID: WP_215284657.1
Location: 330919..331509 (591 bp)
Type: Others
Protein ID: WP_215366349.1
Type: Others
Protein ID: WP_215366349.1
Location: 331506..333206 (1701 bp)
Type: Others
Protein ID: WP_215380767.1
Type: Others
Protein ID: WP_215380767.1
Location: 334352..334711 (360 bp)
Type: Others
Protein ID: WP_112294892.1
Type: Others
Protein ID: WP_112294892.1
Location: 334725..334946 (222 bp)
Type: Others
Protein ID: WP_215380769.1
Type: Others
Protein ID: WP_215380769.1
Location: 337099..337626 (528 bp)
Type: Others
Protein ID: WP_112208855.1
Type: Others
Protein ID: WP_112208855.1
Location: 337643..337954 (312 bp)
Type: Others
Protein ID: WP_255880001.1
Type: Others
Protein ID: WP_255880001.1
Location: 337981..338298 (318 bp)
Type: Others
Protein ID: WP_215380772.1
Type: Others
Protein ID: WP_215380772.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AOC06_RS01830 (AOC06_01830) | 328720..329739 | - | 1020 | WP_112294897.1 | ionic transporter y4hA | - |
AOC06_RS01835 (AOC06_01835) | 329810..330172 | + | 363 | WP_215284471.1 | CbiX/SirB N-terminal domain-containing protein | - |
AOC06_RS01840 (AOC06_01840) | 330095..330907 | - | 813 | WP_215284657.1 | uroporphyrinogen-III C-methyltransferase | - |
AOC06_RS01845 (AOC06_01845) | 330919..331509 | - | 591 | WP_215366349.1 | DUF934 domain-containing protein | - |
AOC06_RS01850 (AOC06_01850) | 331506..333206 | - | 1701 | WP_215380767.1 | nitrite/sulfite reductase | - |
AOC06_RS01855 (AOC06_01855) | 333378..333656 | + | 279 | WP_112203122.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
AOC06_RS01860 (AOC06_01860) | 333664..333969 | + | 306 | WP_215272412.1 | HigA family addiction module antitoxin | Antitoxin |
AOC06_RS01865 (AOC06_01865) | 334020..334268 | + | 249 | WP_112203124.1 | prevent-host-death family protein | - |
AOC06_RS01870 (AOC06_01870) | 334352..334711 | - | 360 | WP_112294892.1 | hypothetical protein | - |
AOC06_RS01875 (AOC06_01875) | 334725..334946 | - | 222 | WP_215380769.1 | hypothetical protein | - |
AOC06_RS01880 (AOC06_01880) | 335129..335722 | + | 594 | WP_112203130.1 | DUF308 domain-containing protein | - |
AOC06_RS01885 (AOC06_01885) | 335765..335935 | + | 171 | WP_158525168.1 | hypothetical protein | - |
AOC06_RS01890 (AOC06_01890) | 336027..337094 | + | 1068 | WP_112294891.1 | acyltransferase | - |
AOC06_RS01895 (AOC06_01895) | 337099..337626 | - | 528 | WP_112208855.1 | ribosome biogenesis factor YjgA | - |
AOC06_RS01900 (AOC06_01900) | 337643..337954 | - | 312 | WP_255880001.1 | helix-turn-helix domain-containing protein | - |
AOC06_RS01905 (AOC06_01905) | 337981..338298 | - | 318 | WP_215380772.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10686.35 Da Isoelectric Point: 10.1614
>T172315 WP_112203122.1 NZ_CP061298:333378-333656 [Polynucleobacter paludilacus]
MIHSFLCGLTKDLFDSKPSKKFGNIERAARRKLLQLHAATAISDLRTPPGNMLELLIGNRRGQYSIRINHQWRICFVWRE
DGAHNVEIVDYH
MIHSFLCGLTKDLFDSKPSKKFGNIERAARRKLLQLHAATAISDLRTPPGNMLELLIGNRRGQYSIRINHQWRICFVWRE
DGAHNVEIVDYH
Download Length: 279 bp
>T172315 NZ_CP079725:1985825-1985927 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 102 a.a. Molecular weight: 11701.62 Da Isoelectric Point: 5.7251
>AT172315 WP_215272412.1 NZ_CP061298:333664-333969 [Polynucleobacter paludilacus]
MTTKLLDEIHPGEILLEDFMKPMGITSRQLAADIDVSPSRISEIIHGTRPITADTALRLGLFFSMEPRFWLNLQSEYDMR
MAKRNLQEEIEPRIRVFRIAA
MTTKLLDEIHPGEILLEDFMKPMGITSRQLAADIDVSPSRISEIIHGTRPITADTALRLGLFFSMEPRFWLNLQSEYDMR
MAKRNLQEEIEPRIRVFRIAA
Download Length: 306 bp
>AT172315 NZ_CP079725:c1985934-1985789 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT