Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4625537..4625756 | Replicon | chromosome |
| Accession | NZ_CP061185 | ||
| Organism | Escherichia coli strain LD67-1 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | IB283_RS21810 | Protein ID | WP_000170738.1 |
| Coordinates | 4625537..4625644 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4625701..4625756 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB283_RS21785 | 4621072..4621260 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| IB283_RS21790 | 4621532..4623103 | + | 1572 | WP_001204946.1 | cellulose biosynthesis protein BcsE | - |
| IB283_RS21795 | 4623100..4623291 | + | 192 | WP_061892928.1 | cellulose biosynthesis protein BcsF | - |
| IB283_RS21800 | 4623288..4624967 | + | 1680 | WP_022646241.1 | cellulose biosynthesis protein BcsG | - |
| IB283_RS21805 | 4625053..4625160 | - | 108 | WP_000170736.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| IB283_RS21810 | 4625537..4625644 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4625701..4625756 | + | 56 | NuclAT_18 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_18 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_18 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_18 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_21 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_21 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_21 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_21 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_24 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_24 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_24 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_24 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_27 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_27 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_27 | - | Antitoxin |
| - | 4625701..4625756 | + | 56 | NuclAT_27 | - | Antitoxin |
| - | 4625701..4625758 | + | 58 | NuclAT_12 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_12 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_12 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_12 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_15 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_15 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_15 | - | - |
| - | 4625701..4625758 | + | 58 | NuclAT_15 | - | - |
| IB283_RS21815 | 4626021..4626128 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4626177..4626240 | + | 64 | NuclAT_19 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_19 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_19 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_19 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_22 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_22 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_22 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_22 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_25 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_25 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_25 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_25 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_28 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_28 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_28 | - | - |
| - | 4626177..4626240 | + | 64 | NuclAT_28 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_13 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_13 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_13 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_13 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_16 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_16 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_16 | - | - |
| - | 4626177..4626242 | + | 66 | NuclAT_16 | - | - |
| IB283_RS21820 | 4626503..4626610 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4626659..4626722 | + | 64 | NuclAT_17 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_17 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_17 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_17 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_20 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_20 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_20 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_20 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_23 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_23 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_23 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_23 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_26 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_26 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_26 | - | - |
| - | 4626659..4626722 | + | 64 | NuclAT_26 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_11 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_11 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_11 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_11 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_14 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_14 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_14 | - | - |
| - | 4626659..4626724 | + | 66 | NuclAT_14 | - | - |
| IB283_RS21825 | 4627086..4628357 | + | 1272 | WP_022646242.1 | amino acid permease | - |
| IB283_RS21830 | 4628387..4629391 | - | 1005 | WP_000107033.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| IB283_RS21835 | 4629388..4630371 | - | 984 | WP_001196481.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T172197 WP_000170738.1 NZ_CP061185:c4625644-4625537 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T172197 NZ_CP079644:55337-55642 [Klebsiella pneumoniae subsp. pneumoniae]
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA
Antitoxin
Download Length: 56 bp
>AT172197 NZ_CP061185:4625701-4625756 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|