Detailed information of TA system TA172197

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4625537..4625756
• Replicon: chromosome
• Accession: NZ_CP061185
• Organism: Escherichia coli strain LD67-1

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: IB283_RS21810
• Protein ID: WP_000170738.1
• Coordinates: 4625537..4625644 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4625701..4625756 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IB283_RS21785	4621072..4621260	-	189	WP_001063314.1	YhjR family protein	-
IB283_RS21790	4621532..4623103	+	1572	WP_001204946.1	cellulose biosynthesis protein BcsE	-
IB283_RS21795	4623100..4623291	+	192	WP_061892928.1	cellulose biosynthesis protein BcsF	-
IB283_RS21800	4623288..4624967	+	1680	WP_022646241.1	cellulose biosynthesis protein BcsG	-
IB283_RS21805	4625053..4625160	-	108	WP_000170736.1	type I toxin-antitoxin system toxin Ldr family protein	-
IB283_RS21810	4625537..4625644	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4625701..4625756	+	56	NuclAT_18	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_18	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_18	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_18	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_21	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_21	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_21	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_21	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_24	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_24	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_24	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_24	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_27	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_27	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_27	-	Antitoxin
-	4625701..4625756	+	56	NuclAT_27	-	Antitoxin
-	4625701..4625758	+	58	NuclAT_12	-	-
-	4625701..4625758	+	58	NuclAT_12	-	-
-	4625701..4625758	+	58	NuclAT_12	-	-
-	4625701..4625758	+	58	NuclAT_12	-	-
-	4625701..4625758	+	58	NuclAT_15	-	-
-	4625701..4625758	+	58	NuclAT_15	-	-
-	4625701..4625758	+	58	NuclAT_15	-	-
-	4625701..4625758	+	58	NuclAT_15	-	-
IB283_RS21815	4626021..4626128	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4626177..4626240	+	64	NuclAT_19	-	-
-	4626177..4626240	+	64	NuclAT_19	-	-
-	4626177..4626240	+	64	NuclAT_19	-	-
-	4626177..4626240	+	64	NuclAT_19	-	-
-	4626177..4626240	+	64	NuclAT_22	-	-
-	4626177..4626240	+	64	NuclAT_22	-	-
-	4626177..4626240	+	64	NuclAT_22	-	-
-	4626177..4626240	+	64	NuclAT_22	-	-
-	4626177..4626240	+	64	NuclAT_25	-	-
-	4626177..4626240	+	64	NuclAT_25	-	-
-	4626177..4626240	+	64	NuclAT_25	-	-
-	4626177..4626240	+	64	NuclAT_25	-	-
-	4626177..4626240	+	64	NuclAT_28	-	-
-	4626177..4626240	+	64	NuclAT_28	-	-
-	4626177..4626240	+	64	NuclAT_28	-	-
-	4626177..4626240	+	64	NuclAT_28	-	-
-	4626177..4626242	+	66	NuclAT_13	-	-
-	4626177..4626242	+	66	NuclAT_13	-	-
-	4626177..4626242	+	66	NuclAT_13	-	-
-	4626177..4626242	+	66	NuclAT_13	-	-
-	4626177..4626242	+	66	NuclAT_16	-	-
-	4626177..4626242	+	66	NuclAT_16	-	-
-	4626177..4626242	+	66	NuclAT_16	-	-
-	4626177..4626242	+	66	NuclAT_16	-	-
IB283_RS21820	4626503..4626610	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4626659..4626722	+	64	NuclAT_17	-	-
-	4626659..4626722	+	64	NuclAT_17	-	-
-	4626659..4626722	+	64	NuclAT_17	-	-
-	4626659..4626722	+	64	NuclAT_17	-	-
-	4626659..4626722	+	64	NuclAT_20	-	-
-	4626659..4626722	+	64	NuclAT_20	-	-
-	4626659..4626722	+	64	NuclAT_20	-	-
-	4626659..4626722	+	64	NuclAT_20	-	-
-	4626659..4626722	+	64	NuclAT_23	-	-
-	4626659..4626722	+	64	NuclAT_23	-	-
-	4626659..4626722	+	64	NuclAT_23	-	-
-	4626659..4626722	+	64	NuclAT_23	-	-
-	4626659..4626722	+	64	NuclAT_26	-	-
-	4626659..4626722	+	64	NuclAT_26	-	-
-	4626659..4626722	+	64	NuclAT_26	-	-
-	4626659..4626722	+	64	NuclAT_26	-	-
-	4626659..4626724	+	66	NuclAT_11	-	-
-	4626659..4626724	+	66	NuclAT_11	-	-
-	4626659..4626724	+	66	NuclAT_11	-	-
-	4626659..4626724	+	66	NuclAT_11	-	-
-	4626659..4626724	+	66	NuclAT_14	-	-
-	4626659..4626724	+	66	NuclAT_14	-	-
-	4626659..4626724	+	66	NuclAT_14	-	-
-	4626659..4626724	+	66	NuclAT_14	-	-
IB283_RS21825	4627086..4628357	+	1272	WP_022646242.1	amino acid permease	-
IB283_RS21830	4628387..4629391	-	1005	WP_000107033.1	dipeptide ABC transporter ATP-binding subunit DppF	-
IB283_RS21835	4629388..4630371	-	984	WP_001196481.1	dipeptide ABC transporter ATP-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T172197 WP_000170738.1 NZ_CP061185:c4625644-4625537 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T172197 NZ_CP079644:55337-55642 [Klebsiella pneumoniae subsp. pneumoniae]
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA

Antitoxin

Nucleotide

• Length: 56 bp

>AT172197 NZ_CP061185:4625701-4625756 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin