Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2718963..2719183 Replicon chromosome
Accession NZ_CP061101
Organism Escherichia coli strain 1EC213

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag IB009_RS13285 Protein ID WP_000170965.1
Coordinates 2719076..2719183 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2718963..2719029 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IB009_RS13260 2714242..2715636 - 1395 WP_000086213.1 inverse autotransporter invasin YchO -
IB009_RS13265 2715821..2716174 + 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
IB009_RS13270 2716218..2716913 - 696 WP_094658721.1 glutathione-specific gamma-glutamylcyclotransferase -
IB009_RS13275 2717071..2717301 - 231 WP_001146442.1 putative cation transport regulator ChaB -
IB009_RS13280 2717571..2718671 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2718963..2719029 - 67 - - Antitoxin
IB009_RS13285 2719076..2719183 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2719496..2719559 - 64 NuclAT_33 - -
- 2719496..2719559 - 64 NuclAT_33 - -
- 2719496..2719559 - 64 NuclAT_33 - -
- 2719496..2719559 - 64 NuclAT_33 - -
- 2719496..2719559 - 64 NuclAT_35 - -
- 2719496..2719559 - 64 NuclAT_35 - -
- 2719496..2719559 - 64 NuclAT_35 - -
- 2719496..2719559 - 64 NuclAT_35 - -
- 2719496..2719559 - 64 NuclAT_37 - -
- 2719496..2719559 - 64 NuclAT_37 - -
- 2719496..2719559 - 64 NuclAT_37 - -
- 2719496..2719559 - 64 NuclAT_37 - -
- 2719496..2719559 - 64 NuclAT_39 - -
- 2719496..2719559 - 64 NuclAT_39 - -
- 2719496..2719559 - 64 NuclAT_39 - -
- 2719496..2719559 - 64 NuclAT_39 - -
- 2719496..2719559 - 64 NuclAT_41 - -
- 2719496..2719559 - 64 NuclAT_41 - -
- 2719496..2719559 - 64 NuclAT_41 - -
- 2719496..2719559 - 64 NuclAT_41 - -
- 2719496..2719559 - 64 NuclAT_43 - -
- 2719496..2719559 - 64 NuclAT_43 - -
- 2719496..2719559 - 64 NuclAT_43 - -
- 2719496..2719559 - 64 NuclAT_43 - -
- 2719497..2719559 - 63 NuclAT_45 - -
- 2719497..2719559 - 63 NuclAT_45 - -
- 2719497..2719559 - 63 NuclAT_45 - -
- 2719497..2719559 - 63 NuclAT_45 - -
- 2719497..2719559 - 63 NuclAT_48 - -
- 2719497..2719559 - 63 NuclAT_48 - -
- 2719497..2719559 - 63 NuclAT_48 - -
- 2719497..2719559 - 63 NuclAT_48 - -
- 2719497..2719559 - 63 NuclAT_51 - -
- 2719497..2719559 - 63 NuclAT_51 - -
- 2719497..2719559 - 63 NuclAT_51 - -
- 2719497..2719559 - 63 NuclAT_51 - -
- 2719498..2719559 - 62 NuclAT_15 - -
- 2719498..2719559 - 62 NuclAT_15 - -
- 2719498..2719559 - 62 NuclAT_15 - -
- 2719498..2719559 - 62 NuclAT_15 - -
- 2719498..2719559 - 62 NuclAT_18 - -
- 2719498..2719559 - 62 NuclAT_18 - -
- 2719498..2719559 - 62 NuclAT_18 - -
- 2719498..2719559 - 62 NuclAT_18 - -
- 2719498..2719559 - 62 NuclAT_21 - -
- 2719498..2719559 - 62 NuclAT_21 - -
- 2719498..2719559 - 62 NuclAT_21 - -
- 2719498..2719559 - 62 NuclAT_21 - -
- 2719498..2719559 - 62 NuclAT_24 - -
- 2719498..2719559 - 62 NuclAT_24 - -
- 2719498..2719559 - 62 NuclAT_24 - -
- 2719498..2719559 - 62 NuclAT_24 - -
- 2719498..2719559 - 62 NuclAT_27 - -
- 2719498..2719559 - 62 NuclAT_27 - -
- 2719498..2719559 - 62 NuclAT_27 - -
- 2719498..2719559 - 62 NuclAT_27 - -
- 2719498..2719559 - 62 NuclAT_30 - -
- 2719498..2719559 - 62 NuclAT_30 - -
- 2719498..2719559 - 62 NuclAT_30 - -
- 2719498..2719559 - 62 NuclAT_30 - -
IB009_RS13290 2719612..2719719 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2720033..2720099 - 67 NuclAT_44 - -
- 2720033..2720099 - 67 NuclAT_44 - -
- 2720033..2720099 - 67 NuclAT_44 - -
- 2720033..2720099 - 67 NuclAT_44 - -
- 2720033..2720099 - 67 NuclAT_47 - -
- 2720033..2720099 - 67 NuclAT_47 - -
- 2720033..2720099 - 67 NuclAT_47 - -
- 2720033..2720099 - 67 NuclAT_47 - -
- 2720033..2720099 - 67 NuclAT_50 - -
- 2720033..2720099 - 67 NuclAT_50 - -
- 2720033..2720099 - 67 NuclAT_50 - -
- 2720033..2720099 - 67 NuclAT_50 - -
- 2720034..2720097 - 64 NuclAT_16 - -
- 2720034..2720097 - 64 NuclAT_16 - -
- 2720034..2720097 - 64 NuclAT_16 - -
- 2720034..2720097 - 64 NuclAT_16 - -
- 2720034..2720097 - 64 NuclAT_19 - -
- 2720034..2720097 - 64 NuclAT_19 - -
- 2720034..2720097 - 64 NuclAT_19 - -
- 2720034..2720097 - 64 NuclAT_19 - -
- 2720034..2720097 - 64 NuclAT_22 - -
- 2720034..2720097 - 64 NuclAT_22 - -
- 2720034..2720097 - 64 NuclAT_22 - -
- 2720034..2720097 - 64 NuclAT_22 - -
- 2720034..2720097 - 64 NuclAT_25 - -
- 2720034..2720097 - 64 NuclAT_25 - -
- 2720034..2720097 - 64 NuclAT_25 - -
- 2720034..2720097 - 64 NuclAT_25 - -
- 2720034..2720097 - 64 NuclAT_28 - -
- 2720034..2720097 - 64 NuclAT_28 - -
- 2720034..2720097 - 64 NuclAT_28 - -
- 2720034..2720097 - 64 NuclAT_28 - -
- 2720034..2720097 - 64 NuclAT_31 - -
- 2720034..2720097 - 64 NuclAT_31 - -
- 2720034..2720097 - 64 NuclAT_31 - -
- 2720034..2720097 - 64 NuclAT_31 - -
IB009_RS13295 2720147..2720254 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
IB009_RS13300 2720403..2721257 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IB009_RS13305 2721293..2722102 - 810 WP_001257044.1 invasion regulator SirB1 -
IB009_RS13310 2722106..2722498 - 393 WP_000200392.1 invasion regulator SirB2 -
IB009_RS13315 2722495..2723328 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T172099 WP_000170965.1 NZ_CP061101:2719076-2719183 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T172099 NZ_CP079224:c26709-26380 [Zymomonas mobilis]
GTGAGTGTCAAAGTAACGACTGTCTGGGTTCCTGTCTGGCTTGAGTTTGATCCGCAGGCGGGCAGGGAGCAGGCTGGGCA
CCGACCTGCTGTTGTGCTGAGTCCTGTCAGCTATAATGCTAAAGCTGGAATGATGCTGTGCTGTCCGACAACGACCAAGA
TCAAAGGCTATCCCTTTGAAGTGGCTCTGACTGGAAAAACTGCCAGTGTGGTTTTGTCAGATCAGGTCAGAAGTCTGGAT
TGGCGCGTGAGAAAGACAAAGCTTAAAGATAAAGTTTTGCCAAAAGAGCTTGAGGCAATTCGGCAGCGCATTAGATTGCT
GGTCGGGTGA

Antitoxin


Download         Length: 67 bp

>AT172099 NZ_CP061101:c2719029-2718963 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References