Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2273318..2273474 | Replicon | chromosome |
Accession | NZ_CP061029 | ||
Organism | Staphylococcus epidermidis strain Z0118SE0132 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | IAU62_RS10900 | Protein ID | WP_099560939.1 |
Coordinates | 2273318..2273413 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2273438..2273474 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IAU62_RS10875 | 2269482..2271110 | + | 1629 | WP_061642462.1 | recombinase family protein | - |
IAU62_RS10880 | 2271615..2271965 | + | 351 | WP_061544230.1 | hypothetical protein | - |
IAU62_RS10885 | 2272052..2272363 | + | 312 | WP_061544231.1 | hypothetical protein | - |
IAU62_RS10890 | 2272378..2272881 | + | 504 | WP_037559702.1 | DUF1643 domain-containing protein | - |
IAU62_RS10895 | 2272896..2273117 | + | 222 | WP_061544232.1 | hypothetical protein | - |
IAU62_RS10900 | 2273318..2273413 | + | 96 | WP_099560939.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2273438..2273474 | - | 37 | - | - | Antitoxin |
IAU62_RS10905 | 2273783..2275021 | - | 1239 | WP_061544233.1 | restriction endonuclease subunit S | - |
IAU62_RS10910 | 2275014..2276570 | - | 1557 | WP_061544234.1 | type I restriction-modification system subunit M | - |
IAU62_RS10915 | 2276571..2277152 | - | 582 | WP_061544235.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3503.15 Da Isoelectric Point: 7.9875
>T171938 WP_099560939.1 NZ_CP061029:2273318-2273413 [Staphylococcus epidermidis]
MADILVNIMTTAASGCIVALFSYWLRKRDDK
MADILVNIMTTAASGCIVALFSYWLRKRDDK
Download Length: 96 bp
>T171938 NZ_CP079110:c1046596-1046471 [Nosocomiicoccus ampullae]
CTGAATGAATATTGGAGATATCGTATAGGAAAATACAGAATAATAACTAGAATTGATGATGATAAAATTATTATTAATAT
CATTTCTGTAGGGCATCGTTCAAATATTTATAAAAAAAACATTTAA
CTGAATGAATATTGGAGATATCGTATAGGAAAATACAGAATAATAACTAGAATTGATGATGATAAAATTATTATTAATAT
CATTTCTGTAGGGCATCGTTCAAATATTTATAAAAAAAACATTTAA
Antitoxin
Download Length: 37 bp
>AT171938 NZ_CP061029:c2273474-2273438 [Staphylococcus epidermidis]
ATGCACCAATCCCCTCACTACTGCCATAGTGAGGGGA
ATGCACCAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|