Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59536..59800 | Replicon | plasmid pEC31-3 |
| Accession | NZ_CP060989 | ||
| Organism | Escherichia coli strain EC31 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | H9212_RS25370 | Protein ID | WP_001331364.1 |
| Coordinates | 59648..59800 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 59536..59593 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9212_RS25355 (54775) | 54775..57066 | - | 2292 | WP_001289272.1 | F-type conjugative transfer protein TrbC | - |
| H9212_RS25360 (57059) | 57059..58129 | - | 1071 | WP_001535705.1 | IncI1-type conjugal transfer protein TrbB | - |
| H9212_RS25365 (58148) | 58148..59356 | - | 1209 | WP_001535704.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (59536) | 59536..59593 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (59536) | 59536..59593 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (59536) | 59536..59593 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (59536) | 59536..59593 | - | 58 | NuclAT_0 | - | Antitoxin |
| H9212_RS25370 (59648) | 59648..59800 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| H9212_RS25375 (59872) | 59872..60123 | - | 252 | WP_001535703.1 | hypothetical protein | - |
| H9212_RS26200 (60624) | 60624..60719 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| H9212_RS25385 (60784) | 60784..60960 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| H9212_RS25390 (61169) | 61169..61378 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| H9212_RS25395 (61476) | 61476..62090 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| H9212_RS25400 (62166) | 62166..64334 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | fosA3 / blaCTX-M-90 / floR / sul2 | - | 1..105686 | 105686 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T171919 WP_001331364.1 NZ_CP060989:59648-59800 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T171919 NZ_CP078521:c2444571-2444464 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 58 bp
>AT171919 NZ_CP060989:c59593-59536 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|