Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 111451..111774 | Replicon | plasmid pEC31-2 |
| Accession | NZ_CP060988 | ||
| Organism | Escherichia coli strain EC31 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | H9212_RS24840 | Protein ID | WP_001372321.1 |
| Coordinates | 111451..111576 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 111653..111774 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9212_RS24805 (106950) | 106950..107552 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| H9212_RS24810 (107849) | 107849..108670 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| H9212_RS24815 (108962) | 108962..110158 | + | 1197 | WP_039023277.1 | IS110-like element ISEc20 family transposase | - |
| H9212_RS24820 (110242) | 110242..110529 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| H9212_RS24825 (110554) | 110554..110760 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| H9212_RS24830 (110830) | 110830..111003 | + | 174 | Protein_120 | hypothetical protein | - |
| H9212_RS24835 (111001) | 111001..111231 | - | 231 | WP_071587244.1 | hypothetical protein | - |
| H9212_RS24840 (111451) | 111451..111576 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H9212_RS24845 (111518) | 111518..111667 | - | 150 | Protein_123 | plasmid maintenance protein Mok | - |
| - (111653) | 111653..111774 | - | 122 | NuclAT_0 | - | Antitoxin |
| - (111653) | 111653..111774 | - | 122 | NuclAT_0 | - | Antitoxin |
| - (111653) | 111653..111774 | - | 122 | NuclAT_0 | - | Antitoxin |
| - (111653) | 111653..111774 | - | 122 | NuclAT_0 | - | Antitoxin |
| H9212_RS24850 (111860) | 111860..112606 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| H9212_RS24855 (112621) | 112621..114162 | - | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| - (114355) | 114355..114463 | - | 109 | NuclAT_1 | - | - |
| - (114355) | 114355..114463 | - | 109 | NuclAT_1 | - | - |
| - (114355) | 114355..114463 | - | 109 | NuclAT_1 | - | - |
| - (114355) | 114355..114463 | - | 109 | NuclAT_1 | - | - |
| H9212_RS24860 (114432) | 114432..115194 | - | 763 | Protein_126 | plasmid SOS inhibition protein A | - |
| H9212_RS24865 (115191) | 115191..115625 | - | 435 | WP_000845934.1 | conjugation system SOS inhibitor PsiB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / qnrS1 / dfrA14 / fosA3 / blaCTX-M-90 / sitABCD | - | 1..141542 | 141542 | |
| - | inside | IScluster/Tn | - | - | 108962..114162 | 5200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T171916 WP_001372321.1 NZ_CP060988:c111576-111451 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T171916 NZ_CP078521:c2101737-2101528 [Staphylococcus aureus]
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGAATATTAATATAATAGATGGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGAATATTAATATAATAGATGGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG
Antitoxin
Download Length: 122 bp
>AT171916 NZ_CP060988:c111774-111653 [Escherichia coli]
AGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAAT
TTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
AGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAAT
TTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|