Detailed information of TA system TA171880

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 114988..115414
• Replicon: plasmid pEC3-2
• Accession: NZ_CP060980
• Organism: Escherichia coli strain EC3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: H9191_RS23500
• Protein ID: WP_001372321.1
• Coordinates: 114988..115113 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	115190..115414 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H9191_RS23460 (110362)	110362..111051	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
H9191_RS23465 (111238)	111238..111621	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
H9191_RS23470 (111942)	111942..112544	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
H9191_RS23475 (112841)	112841..113662	-	822	WP_001234426.1	DUF932 domain-containing protein	-
H9191_RS23480 (113780)	113780..114067	-	288	WP_063121090.1	hypothetical protein	-
H9191_RS23485 (114092)	114092..114298	-	207	WP_000547968.1	hypothetical protein	-
H9191_RS23490 (114368)	114368..114540	+	173	Protein_124	hypothetical protein	-
H9191_RS23495 (114538)	114538..114768	-	231	WP_071586998.1	hypothetical protein	-
H9191_RS23500 (114988)	114988..115113	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
H9191_RS23505 (115055)	115055..115204	-	150	Protein_127	plasmid maintenance protein Mok	-
- (115190)	115190..115414	-	225	NuclAT_0	-	Antitoxin
- (115190)	115190..115414	-	225	NuclAT_0	-	Antitoxin
- (115190)	115190..115414	-	225	NuclAT_0	-	Antitoxin
- (115190)	115190..115414	-	225	NuclAT_0	-	Antitoxin
H9191_RS23510 (115226)	115226..115414	+	189	WP_001299721.1	hypothetical protein	-
H9191_RS23515 (115383)	115383..116145	-	763	Protein_129	plasmid SOS inhibition protein A	-
H9191_RS23520 (116142)	116142..116576	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
H9191_RS23525 (116631)	116631..116828	-	198	Protein_131	hypothetical protein	-
H9191_RS23530 (116856)	116856..117089	-	234	WP_000005987.1	DUF905 family protein	-
H9191_RS23535 (117157)	117157..117696	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
H9191_RS23540 (117722)	117722..117928	-	207	WP_000275856.1	hypothetical protein	-
H9191_RS23545 (117998)	117998..118078	+	81	Protein_135	hypothetical protein	-
H9191_RS23550 (118261)	118261..118430	-	170	Protein_136	hypothetical protein	-
H9191_RS23555 (119024)	119024..119995	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1C / dfrA14 / qnrS1 / tet(A) / floR / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..140376	140376

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T171880 WP_001372321.1 NZ_CP060980:c115113-114988 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T171880 NZ_CP060980:c115113-114988 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 225 bp

>AT171880 NZ_CP060980:c115414-115190 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin