Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4046430..4046650 | Replicon | chromosome |
| Accession | NZ_CP060950 | ||
| Organism | Escherichia coli strain EC9 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | H9196_RS19460 | Protein ID | WP_000170954.1 |
| Coordinates | 4046430..4046537 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4046587..4046650 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9196_RS19435 (4042274) | 4042274..4043356 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| H9196_RS19440 (4043356) | 4043356..4044189 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| H9196_RS19445 (4044186) | 4044186..4044578 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| H9196_RS19450 (4044582) | 4044582..4045391 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| H9196_RS19455 (4045427) | 4045427..4046281 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| H9196_RS19460 (4046430) | 4046430..4046537 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_45 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_45 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_45 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_45 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_48 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_48 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_48 | - | Antitoxin |
| - (4046587) | 4046587..4046650 | + | 64 | NuclAT_48 | - | Antitoxin |
| H9196_RS19465 (4046965) | 4046965..4047072 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_44 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_44 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_44 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_44 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_47 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_47 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_47 | - | - |
| - (4047125) | 4047125..4047186 | + | 62 | NuclAT_47 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_14 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_14 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_14 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_14 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_16 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_16 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_16 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_16 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_18 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_18 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_18 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_18 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_20 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_20 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_20 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_20 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_22 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_22 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_22 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_22 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_24 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_24 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_24 | - | - |
| - (4047125) | 4047125..4047188 | + | 64 | NuclAT_24 | - | - |
| H9196_RS19470 (4047501) | 4047501..4047608 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_43 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_43 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_43 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_43 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_46 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_46 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_46 | - | - |
| - (4047656) | 4047656..4047721 | + | 66 | NuclAT_46 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_13 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_13 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_13 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_13 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_15 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_15 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_15 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_15 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_17 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_17 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_17 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_17 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_19 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_19 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_19 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_19 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_21 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_21 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_21 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_21 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_23 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_23 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_23 | - | - |
| - (4047656) | 4047656..4047723 | + | 68 | NuclAT_23 | - | - |
| H9196_RS19475 (4048013) | 4048013..4049113 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| H9196_RS19480 (4049383) | 4049383..4049613 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| H9196_RS19485 (4049771) | 4049771..4050466 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| H9196_RS19490 (4050510) | 4050510..4050863 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T171697 WP_000170954.1 NZ_CP060950:c4046537-4046430 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T171697 NZ_CP078030:c13554-13252 [Acinetobacter variabilis]
ATGTACTCAATATATACCACTGAAGTCTTTGATGACTGGTTCACCAAGTTAAAAGACCAGCAGGCAAAAAGACGCATACA
AGTCCGAATTGATCGGGTTGAAGATGGAAACTTTGGAGATACTGAGCCGGTCGGTGAAGGTGTTTCTGAATTACGTTTCT
TCTTTGGGCCAGGCTATAGGATTTATTACTGCAAGCAAGGGCAAAGGGTTGTTATTCTTTTAGCAGGCGGAGATAAGTCT
ACGCAAAGTAAAGATATAAAACTTGCCCTGCAATTGGCACAAGATTTAGAGGAGGAGCTATAA
ATGTACTCAATATATACCACTGAAGTCTTTGATGACTGGTTCACCAAGTTAAAAGACCAGCAGGCAAAAAGACGCATACA
AGTCCGAATTGATCGGGTTGAAGATGGAAACTTTGGAGATACTGAGCCGGTCGGTGAAGGTGTTTCTGAATTACGTTTCT
TCTTTGGGCCAGGCTATAGGATTTATTACTGCAAGCAAGGGCAAAGGGTTGTTATTCTTTTAGCAGGCGGAGATAAGTCT
ACGCAAAGTAAAGATATAAAACTTGCCCTGCAATTGGCACAAGATTTAGAGGAGGAGCTATAA
Antitoxin
Download Length: 64 bp
>AT171697 NZ_CP060950:4046587-4046650 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|