Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4046430..4046650 Replicon chromosome
Accession NZ_CP060950
Organism Escherichia coli strain EC9

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag H9196_RS19460 Protein ID WP_000170954.1
Coordinates 4046430..4046537 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4046587..4046650 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H9196_RS19435 (4042274) 4042274..4043356 + 1083 WP_000804726.1 peptide chain release factor 1 -
H9196_RS19440 (4043356) 4043356..4044189 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
H9196_RS19445 (4044186) 4044186..4044578 + 393 WP_000200378.1 invasion regulator SirB2 -
H9196_RS19450 (4044582) 4044582..4045391 + 810 WP_001257044.1 invasion regulator SirB1 -
H9196_RS19455 (4045427) 4045427..4046281 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H9196_RS19460 (4046430) 4046430..4046537 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4046587) 4046587..4046650 + 64 NuclAT_45 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_45 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_45 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_45 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_48 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_48 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_48 - Antitoxin
- (4046587) 4046587..4046650 + 64 NuclAT_48 - Antitoxin
H9196_RS19465 (4046965) 4046965..4047072 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4047125) 4047125..4047186 + 62 NuclAT_44 - -
- (4047125) 4047125..4047186 + 62 NuclAT_44 - -
- (4047125) 4047125..4047186 + 62 NuclAT_44 - -
- (4047125) 4047125..4047186 + 62 NuclAT_44 - -
- (4047125) 4047125..4047186 + 62 NuclAT_47 - -
- (4047125) 4047125..4047186 + 62 NuclAT_47 - -
- (4047125) 4047125..4047186 + 62 NuclAT_47 - -
- (4047125) 4047125..4047186 + 62 NuclAT_47 - -
- (4047125) 4047125..4047188 + 64 NuclAT_14 - -
- (4047125) 4047125..4047188 + 64 NuclAT_14 - -
- (4047125) 4047125..4047188 + 64 NuclAT_14 - -
- (4047125) 4047125..4047188 + 64 NuclAT_14 - -
- (4047125) 4047125..4047188 + 64 NuclAT_16 - -
- (4047125) 4047125..4047188 + 64 NuclAT_16 - -
- (4047125) 4047125..4047188 + 64 NuclAT_16 - -
- (4047125) 4047125..4047188 + 64 NuclAT_16 - -
- (4047125) 4047125..4047188 + 64 NuclAT_18 - -
- (4047125) 4047125..4047188 + 64 NuclAT_18 - -
- (4047125) 4047125..4047188 + 64 NuclAT_18 - -
- (4047125) 4047125..4047188 + 64 NuclAT_18 - -
- (4047125) 4047125..4047188 + 64 NuclAT_20 - -
- (4047125) 4047125..4047188 + 64 NuclAT_20 - -
- (4047125) 4047125..4047188 + 64 NuclAT_20 - -
- (4047125) 4047125..4047188 + 64 NuclAT_20 - -
- (4047125) 4047125..4047188 + 64 NuclAT_22 - -
- (4047125) 4047125..4047188 + 64 NuclAT_22 - -
- (4047125) 4047125..4047188 + 64 NuclAT_22 - -
- (4047125) 4047125..4047188 + 64 NuclAT_22 - -
- (4047125) 4047125..4047188 + 64 NuclAT_24 - -
- (4047125) 4047125..4047188 + 64 NuclAT_24 - -
- (4047125) 4047125..4047188 + 64 NuclAT_24 - -
- (4047125) 4047125..4047188 + 64 NuclAT_24 - -
H9196_RS19470 (4047501) 4047501..4047608 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4047656) 4047656..4047721 + 66 NuclAT_43 - -
- (4047656) 4047656..4047721 + 66 NuclAT_43 - -
- (4047656) 4047656..4047721 + 66 NuclAT_43 - -
- (4047656) 4047656..4047721 + 66 NuclAT_43 - -
- (4047656) 4047656..4047721 + 66 NuclAT_46 - -
- (4047656) 4047656..4047721 + 66 NuclAT_46 - -
- (4047656) 4047656..4047721 + 66 NuclAT_46 - -
- (4047656) 4047656..4047721 + 66 NuclAT_46 - -
- (4047656) 4047656..4047723 + 68 NuclAT_13 - -
- (4047656) 4047656..4047723 + 68 NuclAT_13 - -
- (4047656) 4047656..4047723 + 68 NuclAT_13 - -
- (4047656) 4047656..4047723 + 68 NuclAT_13 - -
- (4047656) 4047656..4047723 + 68 NuclAT_15 - -
- (4047656) 4047656..4047723 + 68 NuclAT_15 - -
- (4047656) 4047656..4047723 + 68 NuclAT_15 - -
- (4047656) 4047656..4047723 + 68 NuclAT_15 - -
- (4047656) 4047656..4047723 + 68 NuclAT_17 - -
- (4047656) 4047656..4047723 + 68 NuclAT_17 - -
- (4047656) 4047656..4047723 + 68 NuclAT_17 - -
- (4047656) 4047656..4047723 + 68 NuclAT_17 - -
- (4047656) 4047656..4047723 + 68 NuclAT_19 - -
- (4047656) 4047656..4047723 + 68 NuclAT_19 - -
- (4047656) 4047656..4047723 + 68 NuclAT_19 - -
- (4047656) 4047656..4047723 + 68 NuclAT_19 - -
- (4047656) 4047656..4047723 + 68 NuclAT_21 - -
- (4047656) 4047656..4047723 + 68 NuclAT_21 - -
- (4047656) 4047656..4047723 + 68 NuclAT_21 - -
- (4047656) 4047656..4047723 + 68 NuclAT_21 - -
- (4047656) 4047656..4047723 + 68 NuclAT_23 - -
- (4047656) 4047656..4047723 + 68 NuclAT_23 - -
- (4047656) 4047656..4047723 + 68 NuclAT_23 - -
- (4047656) 4047656..4047723 + 68 NuclAT_23 - -
H9196_RS19475 (4048013) 4048013..4049113 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
H9196_RS19480 (4049383) 4049383..4049613 + 231 WP_001146442.1 putative cation transport regulator ChaB -
H9196_RS19485 (4049771) 4049771..4050466 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H9196_RS19490 (4050510) 4050510..4050863 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T171697 WP_000170954.1 NZ_CP060950:c4046537-4046430 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T171697 NZ_CP078030:c13554-13252 [Acinetobacter variabilis]
ATGTACTCAATATATACCACTGAAGTCTTTGATGACTGGTTCACCAAGTTAAAAGACCAGCAGGCAAAAAGACGCATACA
AGTCCGAATTGATCGGGTTGAAGATGGAAACTTTGGAGATACTGAGCCGGTCGGTGAAGGTGTTTCTGAATTACGTTTCT
TCTTTGGGCCAGGCTATAGGATTTATTACTGCAAGCAAGGGCAAAGGGTTGTTATTCTTTTAGCAGGCGGAGATAAGTCT
ACGCAAAGTAAAGATATAAAACTTGCCCTGCAATTGGCACAAGATTTAGAGGAGGAGCTATAA

Antitoxin


Download         Length: 64 bp

>AT171697 NZ_CP060950:4046587-4046650 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References