Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 321467..321687 Replicon chromosome
Accession NZ_CP060946
Organism Escherichia coli O157:H7 str. EC10

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag H9197_RS01605 Protein ID WP_000170954.1
Coordinates 321467..321574 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 321624..321687 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H9197_RS01580 (317311) 317311..318393 + 1083 WP_000804726.1 peptide chain release factor 1 -
H9197_RS01585 (318393) 318393..319226 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
H9197_RS01590 (319223) 319223..319615 + 393 WP_000200378.1 invasion regulator SirB2 -
H9197_RS01595 (319619) 319619..320428 + 810 WP_001257044.1 invasion regulator SirB1 -
H9197_RS01600 (320464) 320464..321318 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H9197_RS01605 (321467) 321467..321574 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (321624) 321624..321687 + 64 NuclAT_44 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_44 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_44 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_44 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_47 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_47 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_47 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_47 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_50 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_50 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_50 - Antitoxin
- (321624) 321624..321687 + 64 NuclAT_50 - Antitoxin
H9197_RS01610 (322002) 322002..322109 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (322162) 322162..322223 + 62 NuclAT_43 - -
- (322162) 322162..322223 + 62 NuclAT_43 - -
- (322162) 322162..322223 + 62 NuclAT_43 - -
- (322162) 322162..322223 + 62 NuclAT_43 - -
- (322162) 322162..322223 + 62 NuclAT_46 - -
- (322162) 322162..322223 + 62 NuclAT_46 - -
- (322162) 322162..322223 + 62 NuclAT_46 - -
- (322162) 322162..322223 + 62 NuclAT_46 - -
- (322162) 322162..322223 + 62 NuclAT_49 - -
- (322162) 322162..322223 + 62 NuclAT_49 - -
- (322162) 322162..322223 + 62 NuclAT_49 - -
- (322162) 322162..322223 + 62 NuclAT_49 - -
- (322162) 322162..322225 + 64 NuclAT_13 - -
- (322162) 322162..322225 + 64 NuclAT_13 - -
- (322162) 322162..322225 + 64 NuclAT_13 - -
- (322162) 322162..322225 + 64 NuclAT_13 - -
- (322162) 322162..322225 + 64 NuclAT_15 - -
- (322162) 322162..322225 + 64 NuclAT_15 - -
- (322162) 322162..322225 + 64 NuclAT_15 - -
- (322162) 322162..322225 + 64 NuclAT_15 - -
- (322162) 322162..322225 + 64 NuclAT_17 - -
- (322162) 322162..322225 + 64 NuclAT_17 - -
- (322162) 322162..322225 + 64 NuclAT_17 - -
- (322162) 322162..322225 + 64 NuclAT_17 - -
- (322162) 322162..322225 + 64 NuclAT_19 - -
- (322162) 322162..322225 + 64 NuclAT_19 - -
- (322162) 322162..322225 + 64 NuclAT_19 - -
- (322162) 322162..322225 + 64 NuclAT_19 - -
- (322162) 322162..322225 + 64 NuclAT_21 - -
- (322162) 322162..322225 + 64 NuclAT_21 - -
- (322162) 322162..322225 + 64 NuclAT_21 - -
- (322162) 322162..322225 + 64 NuclAT_21 - -
- (322162) 322162..322225 + 64 NuclAT_23 - -
- (322162) 322162..322225 + 64 NuclAT_23 - -
- (322162) 322162..322225 + 64 NuclAT_23 - -
- (322162) 322162..322225 + 64 NuclAT_23 - -
H9197_RS01615 (322538) 322538..322645 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (322693) 322693..322758 + 66 NuclAT_42 - -
- (322693) 322693..322758 + 66 NuclAT_42 - -
- (322693) 322693..322758 + 66 NuclAT_42 - -
- (322693) 322693..322758 + 66 NuclAT_42 - -
- (322693) 322693..322758 + 66 NuclAT_45 - -
- (322693) 322693..322758 + 66 NuclAT_45 - -
- (322693) 322693..322758 + 66 NuclAT_45 - -
- (322693) 322693..322758 + 66 NuclAT_45 - -
- (322693) 322693..322758 + 66 NuclAT_48 - -
- (322693) 322693..322758 + 66 NuclAT_48 - -
- (322693) 322693..322758 + 66 NuclAT_48 - -
- (322693) 322693..322758 + 66 NuclAT_48 - -
- (322693) 322693..322760 + 68 NuclAT_12 - -
- (322693) 322693..322760 + 68 NuclAT_12 - -
- (322693) 322693..322760 + 68 NuclAT_12 - -
- (322693) 322693..322760 + 68 NuclAT_12 - -
- (322693) 322693..322760 + 68 NuclAT_14 - -
- (322693) 322693..322760 + 68 NuclAT_14 - -
- (322693) 322693..322760 + 68 NuclAT_14 - -
- (322693) 322693..322760 + 68 NuclAT_14 - -
- (322693) 322693..322760 + 68 NuclAT_16 - -
- (322693) 322693..322760 + 68 NuclAT_16 - -
- (322693) 322693..322760 + 68 NuclAT_16 - -
- (322693) 322693..322760 + 68 NuclAT_16 - -
- (322693) 322693..322760 + 68 NuclAT_18 - -
- (322693) 322693..322760 + 68 NuclAT_18 - -
- (322693) 322693..322760 + 68 NuclAT_18 - -
- (322693) 322693..322760 + 68 NuclAT_18 - -
- (322693) 322693..322760 + 68 NuclAT_20 - -
- (322693) 322693..322760 + 68 NuclAT_20 - -
- (322693) 322693..322760 + 68 NuclAT_20 - -
- (322693) 322693..322760 + 68 NuclAT_20 - -
- (322693) 322693..322760 + 68 NuclAT_22 - -
- (322693) 322693..322760 + 68 NuclAT_22 - -
- (322693) 322693..322760 + 68 NuclAT_22 - -
- (322693) 322693..322760 + 68 NuclAT_22 - -
H9197_RS01620 (323050) 323050..324150 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
H9197_RS01625 (324420) 324420..324650 + 231 WP_001146442.1 putative cation transport regulator ChaB -
H9197_RS01630 (324808) 324808..325503 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H9197_RS01635 (325547) 325547..325900 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T171648 WP_000170954.1 NZ_CP060946:c321574-321467 [Escherichia coli O157:H7 str. EC10]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T171648 NZ_CP078006:c5863635-5863345 [Pseudomonas aeruginosa]
ATGACCGAGCAAATTTATGATTATGACCCCGCGCAAGCGCTGGACAGCCCGGAGGCCATGGCTCTGTTCATCGCAGACGC
TTTGGATACTGGAGACACCGCCTATATCGCTAAGGCTATGGGAGTCGTGGCCCGCGCCAAGGGGATGACGGAGTTGGCCA
AGGAAACGGGTTTGGCCAGGGAGCAGCTTTACAAATCGTTTAGTGAGCGCGGGAACCCTACATTGAAAACCATGCTGGCA
GTAATGCGAGCTCTGGGAGTTGATCTGACCGCCCGCCCGCATGCTCAGTGA

Antitoxin


Download         Length: 64 bp

>AT171648 NZ_CP060946:321624-321687 [Escherichia coli O157:H7 str. EC10]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References