Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 321467..321687 | Replicon | chromosome |
| Accession | NZ_CP060946 | ||
| Organism | Escherichia coli O157:H7 str. EC10 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | H9197_RS01605 | Protein ID | WP_000170954.1 |
| Coordinates | 321467..321574 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 321624..321687 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9197_RS01580 (317311) | 317311..318393 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| H9197_RS01585 (318393) | 318393..319226 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| H9197_RS01590 (319223) | 319223..319615 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| H9197_RS01595 (319619) | 319619..320428 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| H9197_RS01600 (320464) | 320464..321318 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| H9197_RS01605 (321467) | 321467..321574 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_50 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_50 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_50 | - | Antitoxin |
| - (321624) | 321624..321687 | + | 64 | NuclAT_50 | - | Antitoxin |
| H9197_RS01610 (322002) | 322002..322109 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_43 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_43 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_43 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_43 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_46 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_46 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_46 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_46 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_49 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_49 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_49 | - | - |
| - (322162) | 322162..322223 | + | 62 | NuclAT_49 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_13 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_13 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_13 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_13 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_15 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_15 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_15 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_15 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_17 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_17 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_17 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_17 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_19 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_19 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_19 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_19 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_21 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_21 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_21 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_21 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_23 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_23 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_23 | - | - |
| - (322162) | 322162..322225 | + | 64 | NuclAT_23 | - | - |
| H9197_RS01615 (322538) | 322538..322645 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_42 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_42 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_42 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_42 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_45 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_45 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_45 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_45 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_48 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_48 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_48 | - | - |
| - (322693) | 322693..322758 | + | 66 | NuclAT_48 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_12 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_12 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_12 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_12 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_14 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_14 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_14 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_14 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_16 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_16 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_16 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_16 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_18 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_18 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_18 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_18 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_20 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_20 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_20 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_20 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_22 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_22 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_22 | - | - |
| - (322693) | 322693..322760 | + | 68 | NuclAT_22 | - | - |
| H9197_RS01620 (323050) | 323050..324150 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| H9197_RS01625 (324420) | 324420..324650 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| H9197_RS01630 (324808) | 324808..325503 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| H9197_RS01635 (325547) | 325547..325900 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T171648 WP_000170954.1 NZ_CP060946:c321574-321467 [Escherichia coli O157:H7 str. EC10]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T171648 NZ_CP078006:c5863635-5863345 [Pseudomonas aeruginosa]
ATGACCGAGCAAATTTATGATTATGACCCCGCGCAAGCGCTGGACAGCCCGGAGGCCATGGCTCTGTTCATCGCAGACGC
TTTGGATACTGGAGACACCGCCTATATCGCTAAGGCTATGGGAGTCGTGGCCCGCGCCAAGGGGATGACGGAGTTGGCCA
AGGAAACGGGTTTGGCCAGGGAGCAGCTTTACAAATCGTTTAGTGAGCGCGGGAACCCTACATTGAAAACCATGCTGGCA
GTAATGCGAGCTCTGGGAGTTGATCTGACCGCCCGCCCGCATGCTCAGTGA
ATGACCGAGCAAATTTATGATTATGACCCCGCGCAAGCGCTGGACAGCCCGGAGGCCATGGCTCTGTTCATCGCAGACGC
TTTGGATACTGGAGACACCGCCTATATCGCTAAGGCTATGGGAGTCGTGGCCCGCGCCAAGGGGATGACGGAGTTGGCCA
AGGAAACGGGTTTGGCCAGGGAGCAGCTTTACAAATCGTTTAGTGAGCGCGGGAACCCTACATTGAAAACCATGCTGGCA
GTAATGCGAGCTCTGGGAGTTGATCTGACCGCCCGCCCGCATGCTCAGTGA
Antitoxin
Download Length: 64 bp
>AT171648 NZ_CP060946:321624-321687 [Escherichia coli O157:H7 str. EC10]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|