Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 43449..43703 | Replicon | plasmid pEC20-2 |
| Accession | NZ_CP060903 | ||
| Organism | Escherichia coli strain EC20 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | H9205_RS23775 | Protein ID | WP_001312851.1 |
| Coordinates | 43449..43598 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 43642..43703 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9205_RS23745 (38696) | 38696..39607 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| H9205_RS23750 (39618) | 39618..40838 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| H9205_RS23755 (41545) | 41545..42159 | + | 615 | Protein_47 | VENN motif pre-toxin domain-containing protein | - |
| H9205_RS23760 (42159) | 42159..42605 | - | 447 | Protein_48 | plasmid replication initiator RepA | - |
| H9205_RS23765 (42598) | 42598..42672 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| H9205_RS23770 (42908) | 42908..43165 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| H9205_RS23775 (43449) | 43449..43598 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (43642) | 43642..43703 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (43642) | 43642..43703 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (43642) | 43642..43703 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (43642) | 43642..43703 | + | 62 | NuclAT_0 | - | Antitoxin |
| H9205_RS23780 (43842) | 43842..44024 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| H9205_RS23785 (44125) | 44125..44741 | + | 617 | Protein_53 | IS1-like element IS1A family transposase | - |
| H9205_RS23790 (44779) | 44779..46350 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| H9205_RS23795 (46370) | 46370..46717 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| H9205_RS23800 (46717) | 46717..47394 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| H9205_RS23805 (47449) | 47449..47538 | + | 90 | Protein_57 | IS1 family transposase | - |
| H9205_RS23810 (47839) | 47839..48051 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaOXA-1 / aac(6')-Ib-cr / tet(A) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..88680 | 88680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T171422 WP_001312851.1 NZ_CP060903:c43598-43449 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T171422 NZ_CP077920:352804-352992 [Staphylococcus aureus]
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
Antitoxin
Download Length: 62 bp
>AT171422 NZ_CP060903:43642-43703 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|