Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 140019..140445 | Replicon | plasmid pEC21-2 |
| Accession | NZ_CP060900 | ||
| Organism | Escherichia coli strain EC21 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | H9206_RS23605 | Protein ID | WP_001372321.1 |
| Coordinates | 140019..140144 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 140221..140445 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9206_RS23560 (135065) | 135065..135292 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| H9206_RS23565 (135386) | 135386..136072 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| H9206_RS23570 (136263) | 136263..136646 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| H9206_RS23575 (136923) | 136923..137570 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| H9206_RS23580 (137867) | 137867..138688 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| H9206_RS23585 (138810) | 138810..139097 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| H9206_RS23590 (139122) | 139122..139328 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| H9206_RS23595 (139398) | 139398..139571 | + | 174 | Protein_151 | hypothetical protein | - |
| H9206_RS23600 (139569) | 139569..139799 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| H9206_RS23605 (140019) | 140019..140144 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H9206_RS23610 (140086) | 140086..140235 | - | 150 | Protein_154 | plasmid maintenance protein Mok | - |
| - (140221) | 140221..140445 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (140221) | 140221..140445 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (140221) | 140221..140445 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (140221) | 140221..140445 | - | 225 | NuclAT_0 | - | Antitoxin |
| H9206_RS23615 (140257) | 140257..140445 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| H9206_RS23620 (140414) | 140414..141176 | - | 763 | Protein_156 | plasmid SOS inhibition protein A | - |
| H9206_RS23625 (141173) | 141173..141607 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| H9206_RS23630 (141662) | 141662..143620 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| H9206_RS23635 (143679) | 143679..143912 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| H9206_RS23640 (143968) | 143968..144495 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| H9206_RS23645 (144968) | 144968..145228 | - | 261 | WP_072132736.1 | hypothetical protein | - |
| H9206_RS23650 (145138) | 145138..145380 | - | 243 | WP_001610271.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T171398 WP_001372321.1 NZ_CP060900:c140144-140019 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T171398 NZ_CP077916:c192665-192513 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGACTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAAAATTCTGAAGAAGACAGTCAGTAA
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGACTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAAAATTCTGAAGAAGACAGTCAGTAA
Antitoxin
Download Length: 225 bp
>AT171398 NZ_CP060900:c140445-140221 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|