Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41126..41390 | Replicon | plasmid pEC24-3 |
Accession | NZ_CP060887 | ||
Organism | Escherichia coli strain EC24 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | H9208_RS24275 | Protein ID | WP_001387489.1 |
Coordinates | 41238..41390 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 41126..41186 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H9208_RS24260 (37228) | 37228..38298 | - | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
H9208_RS24265 (38317) | 38317..39525 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
- (39705) | 39705..39762 | - | 58 | NuclAT_1 | - | - |
- (39705) | 39705..39762 | - | 58 | NuclAT_1 | - | - |
- (39705) | 39705..39762 | - | 58 | NuclAT_1 | - | - |
- (39705) | 39705..39762 | - | 58 | NuclAT_1 | - | - |
H9208_RS24270 (39832) | 39832..40611 | - | 780 | WP_275450201.1 | protein FinQ | - |
- (41126) | 41126..41186 | - | 61 | NuclAT_0 | - | Antitoxin |
- (41126) | 41126..41186 | - | 61 | NuclAT_0 | - | Antitoxin |
- (41126) | 41126..41186 | - | 61 | NuclAT_0 | - | Antitoxin |
- (41126) | 41126..41186 | - | 61 | NuclAT_0 | - | Antitoxin |
H9208_RS24275 (41238) | 41238..41390 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
H9208_RS24280 (41462) | 41462..41713 | - | 252 | WP_001291964.1 | hypothetical protein | - |
H9208_RS24950 (42214) | 42214..42309 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
H9208_RS24290 (42374) | 42374..42550 | - | 177 | WP_001054900.1 | hypothetical protein | - |
H9208_RS24295 (42942) | 42942..43151 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
H9208_RS24300 (43223) | 43223..43885 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
H9208_RS24305 (43956) | 43956..46124 | - | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 | - | 1..86975 | 86975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T171342 WP_001387489.1 NZ_CP060887:41238-41390 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T171342 NZ_CP077893:c774817-774722 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 61 bp
>AT171342 NZ_CP060887:c41186-41126 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|