Detailed information of TA system TA171313

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 40056..40325
• Replicon: plasmid pEC26-3
• Accession: NZ_CP060882
• Organism: Escherichia coli strain EC26

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: H9209_RS24280
• Protein ID: WP_001372321.1
• Coordinates: 40200..40325 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	40056..40121 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H9209_RS24235	35284..35535	+	252	WP_077879800.1	hypothetical protein	-
H9209_RS24240	35680..35886	+	207	WP_015059635.1	hypothetical protein	-
H9209_RS24245	35912..36364	+	453	WP_063072992.1	single-stranded DNA-binding protein	-
H9209_RS24250	36426..36659	+	234	WP_000006030.1	DUF905 family protein	-
H9209_RS24255	36724..38682	+	1959	WP_063072993.1	ParB/RepB/Spo0J family partition protein	-
H9209_RS24260	38737..39171	+	435	WP_000845907.1	conjugation system SOS inhibitor PsiB	-
H9209_RS24265	39168..39930	+	763	Protein_52	plasmid SOS inhibition protein A	-
H9209_RS24270	39899..40087	-	189	WP_001299721.1	hypothetical protein	-
-	39899..40123	+	225	NuclAT_0	-	-
-	39899..40123	+	225	NuclAT_0	-	-
-	39899..40123	+	225	NuclAT_0	-	-
-	39899..40123	+	225	NuclAT_0	-	-
-	40056..40121	-	66	-	-	Antitoxin
H9209_RS24275	40109..40258	+	150	Protein_54	plasmid maintenance protein Mok	-
H9209_RS24280	40200..40325	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
H9209_RS24285	40545..40775	+	231	WP_071845785.1	hypothetical protein	-
H9209_RS24290	40773..40946	-	174	Protein_57	hypothetical protein	-
H9209_RS24295	41016..41222	+	207	WP_063609967.1	hypothetical protein	-
H9209_RS24300	41247..41534	+	288	WP_063072995.1	hypothetical protein	-
H9209_RS24305	41653..42474	+	822	WP_001241365.1	DUF932 domain-containing protein	-
H9209_RS24310	42771..43361	-	591	WP_222908884.1	transglycosylase SLT domain-containing protein	-
H9209_RS24315	43694..44077	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
H9209_RS24320	44264..44953	+	690	WP_000283379.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..79683	79683

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T171313 WP_001372321.1 NZ_CP060882:40200-40325 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T171313 NZ_CP077885:c1944030-1943926 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT171313 NZ_CP060882:c40121-40056 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin