Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1435074..1435296 Replicon chromosome
Accession NZ_CP060709
Organism Escherichia coli strain ST18

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag H9445_RS07275 Protein ID WP_000170963.1
Coordinates 1435074..1435181 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1435229..1435296 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H9445_RS07245 1430383..1431465 + 1083 WP_000804726.1 peptide chain release factor 1 -
H9445_RS07250 1431465..1432298 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
H9445_RS07255 1432295..1432687 + 393 WP_000200374.1 invasion regulator SirB2 -
H9445_RS07260 1432691..1433500 + 810 WP_001257044.1 invasion regulator SirB1 -
H9445_RS07265 1433536..1434390 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H9445_RS07270 1434539..1434646 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1434694..1434760 + 67 NuclAT_34 - -
- 1434694..1434760 + 67 NuclAT_34 - -
- 1434694..1434760 + 67 NuclAT_34 - -
- 1434694..1434760 + 67 NuclAT_34 - -
- 1434694..1434760 + 67 NuclAT_36 - -
- 1434694..1434760 + 67 NuclAT_36 - -
- 1434694..1434760 + 67 NuclAT_36 - -
- 1434694..1434760 + 67 NuclAT_36 - -
- 1434694..1434760 + 67 NuclAT_38 - -
- 1434694..1434760 + 67 NuclAT_38 - -
- 1434694..1434760 + 67 NuclAT_38 - -
- 1434694..1434760 + 67 NuclAT_38 - -
- 1434694..1434760 + 67 NuclAT_40 - -
- 1434694..1434760 + 67 NuclAT_40 - -
- 1434694..1434760 + 67 NuclAT_40 - -
- 1434694..1434760 + 67 NuclAT_40 - -
- 1434694..1434760 + 67 NuclAT_42 - -
- 1434694..1434760 + 67 NuclAT_42 - -
- 1434694..1434760 + 67 NuclAT_42 - -
- 1434694..1434760 + 67 NuclAT_42 - -
- 1434694..1434760 + 67 NuclAT_44 - -
- 1434694..1434760 + 67 NuclAT_44 - -
- 1434694..1434760 + 67 NuclAT_44 - -
- 1434694..1434760 + 67 NuclAT_44 - -
- 1434696..1434761 + 66 NuclAT_18 - -
- 1434696..1434761 + 66 NuclAT_18 - -
- 1434696..1434761 + 66 NuclAT_18 - -
- 1434696..1434761 + 66 NuclAT_18 - -
- 1434696..1434761 + 66 NuclAT_21 - -
- 1434696..1434761 + 66 NuclAT_21 - -
- 1434696..1434761 + 66 NuclAT_21 - -
- 1434696..1434761 + 66 NuclAT_21 - -
- 1434696..1434761 + 66 NuclAT_24 - -
- 1434696..1434761 + 66 NuclAT_24 - -
- 1434696..1434761 + 66 NuclAT_24 - -
- 1434696..1434761 + 66 NuclAT_24 - -
- 1434696..1434761 + 66 NuclAT_27 - -
- 1434696..1434761 + 66 NuclAT_27 - -
- 1434696..1434761 + 66 NuclAT_27 - -
- 1434696..1434761 + 66 NuclAT_27 - -
- 1434696..1434761 + 66 NuclAT_30 - -
- 1434696..1434761 + 66 NuclAT_30 - -
- 1434696..1434761 + 66 NuclAT_30 - -
- 1434696..1434761 + 66 NuclAT_30 - -
- 1434696..1434761 + 66 NuclAT_33 - -
- 1434696..1434761 + 66 NuclAT_33 - -
- 1434696..1434761 + 66 NuclAT_33 - -
- 1434696..1434761 + 66 NuclAT_33 - -
H9445_RS07275 1435074..1435181 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1435229..1435296 + 68 NuclAT_17 - Antitoxin
- 1435229..1435296 + 68 NuclAT_17 - Antitoxin
- 1435229..1435296 + 68 NuclAT_17 - Antitoxin
- 1435229..1435296 + 68 NuclAT_17 - Antitoxin
- 1435229..1435296 + 68 NuclAT_20 - Antitoxin
- 1435229..1435296 + 68 NuclAT_20 - Antitoxin
- 1435229..1435296 + 68 NuclAT_20 - Antitoxin
- 1435229..1435296 + 68 NuclAT_20 - Antitoxin
- 1435229..1435296 + 68 NuclAT_23 - Antitoxin
- 1435229..1435296 + 68 NuclAT_23 - Antitoxin
- 1435229..1435296 + 68 NuclAT_23 - Antitoxin
- 1435229..1435296 + 68 NuclAT_23 - Antitoxin
- 1435229..1435296 + 68 NuclAT_26 - Antitoxin
- 1435229..1435296 + 68 NuclAT_26 - Antitoxin
- 1435229..1435296 + 68 NuclAT_26 - Antitoxin
- 1435229..1435296 + 68 NuclAT_26 - Antitoxin
- 1435229..1435296 + 68 NuclAT_29 - Antitoxin
- 1435229..1435296 + 68 NuclAT_29 - Antitoxin
- 1435229..1435296 + 68 NuclAT_29 - Antitoxin
- 1435229..1435296 + 68 NuclAT_29 - Antitoxin
- 1435229..1435296 + 68 NuclAT_32 - Antitoxin
- 1435229..1435296 + 68 NuclAT_32 - Antitoxin
- 1435229..1435296 + 68 NuclAT_32 - Antitoxin
- 1435229..1435296 + 68 NuclAT_32 - Antitoxin
- 1435230..1435295 + 66 NuclAT_35 - -
- 1435230..1435295 + 66 NuclAT_35 - -
- 1435230..1435295 + 66 NuclAT_35 - -
- 1435230..1435295 + 66 NuclAT_35 - -
- 1435230..1435295 + 66 NuclAT_37 - -
- 1435230..1435295 + 66 NuclAT_37 - -
- 1435230..1435295 + 66 NuclAT_37 - -
- 1435230..1435295 + 66 NuclAT_37 - -
- 1435230..1435295 + 66 NuclAT_39 - -
- 1435230..1435295 + 66 NuclAT_39 - -
- 1435230..1435295 + 66 NuclAT_39 - -
- 1435230..1435295 + 66 NuclAT_39 - -
- 1435230..1435295 + 66 NuclAT_41 - -
- 1435230..1435295 + 66 NuclAT_41 - -
- 1435230..1435295 + 66 NuclAT_41 - -
- 1435230..1435295 + 66 NuclAT_41 - -
- 1435230..1435295 + 66 NuclAT_43 - -
- 1435230..1435295 + 66 NuclAT_43 - -
- 1435230..1435295 + 66 NuclAT_43 - -
- 1435230..1435295 + 66 NuclAT_43 - -
- 1435230..1435295 + 66 NuclAT_45 - -
- 1435230..1435295 + 66 NuclAT_45 - -
- 1435230..1435295 + 66 NuclAT_45 - -
- 1435230..1435295 + 66 NuclAT_45 - -
H9445_RS07280 1435609..1435716 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1435764..1435831 + 68 NuclAT_16 - -
- 1435764..1435831 + 68 NuclAT_16 - -
- 1435764..1435831 + 68 NuclAT_16 - -
- 1435764..1435831 + 68 NuclAT_16 - -
- 1435764..1435831 + 68 NuclAT_19 - -
- 1435764..1435831 + 68 NuclAT_19 - -
- 1435764..1435831 + 68 NuclAT_19 - -
- 1435764..1435831 + 68 NuclAT_19 - -
- 1435764..1435831 + 68 NuclAT_22 - -
- 1435764..1435831 + 68 NuclAT_22 - -
- 1435764..1435831 + 68 NuclAT_22 - -
- 1435764..1435831 + 68 NuclAT_22 - -
- 1435764..1435831 + 68 NuclAT_25 - -
- 1435764..1435831 + 68 NuclAT_25 - -
- 1435764..1435831 + 68 NuclAT_25 - -
- 1435764..1435831 + 68 NuclAT_25 - -
- 1435764..1435831 + 68 NuclAT_28 - -
- 1435764..1435831 + 68 NuclAT_28 - -
- 1435764..1435831 + 68 NuclAT_28 - -
- 1435764..1435831 + 68 NuclAT_28 - -
- 1435764..1435831 + 68 NuclAT_31 - -
- 1435764..1435831 + 68 NuclAT_31 - -
- 1435764..1435831 + 68 NuclAT_31 - -
- 1435764..1435831 + 68 NuclAT_31 - -
H9445_RS07285 1436120..1437220 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
H9445_RS07290 1437490..1437720 + 231 WP_001146444.1 putative cation transport regulator ChaB -
H9445_RS07295 1437878..1438573 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
H9445_RS07300 1438617..1438970 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T170810 WP_000170963.1 NZ_CP060709:c1435181-1435074 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T170810 NZ_CP077710:3355244-3355426 [Salmonella enterica subsp. enterica]
ATGAAATACAACGAGTTCAGGCGGTGGCTCATCCGACAAGGTGCAAAGTTTATCAATGCGCCAGGTGGCGGGAGTCATCA
ACGCGTCATACTAAACGGCAGGGAATCAGTATTTCCCTACCACGGCGCTAAAGAGATACCGGAGCCACTAAGAAAGAAAA
TACTCAAGGATTTGGGGCTGTAA

Antitoxin


Download         Length: 68 bp

>AT170810 NZ_CP060709:1435229-1435296 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References