Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1269108..1269330 Replicon chromosome
Accession NZ_CP060708
Organism Escherichia coli strain MFDpir

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag H9446_RS06190 Protein ID WP_000170963.1
Coordinates 1269108..1269215 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1269263..1269330 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H9446_RS06160 1264417..1265499 + 1083 WP_000804726.1 peptide chain release factor 1 -
H9446_RS06165 1265499..1266332 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
H9446_RS06170 1266329..1266721 + 393 WP_000200374.1 invasion regulator SirB2 -
H9446_RS06175 1266725..1267534 + 810 WP_001257044.1 invasion regulator SirB1 -
H9446_RS06180 1267570..1268424 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H9446_RS06185 1268573..1268680 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1268728..1268794 + 67 NuclAT_34 - -
- 1268728..1268794 + 67 NuclAT_34 - -
- 1268728..1268794 + 67 NuclAT_34 - -
- 1268728..1268794 + 67 NuclAT_34 - -
- 1268728..1268794 + 67 NuclAT_36 - -
- 1268728..1268794 + 67 NuclAT_36 - -
- 1268728..1268794 + 67 NuclAT_36 - -
- 1268728..1268794 + 67 NuclAT_36 - -
- 1268728..1268794 + 67 NuclAT_38 - -
- 1268728..1268794 + 67 NuclAT_38 - -
- 1268728..1268794 + 67 NuclAT_38 - -
- 1268728..1268794 + 67 NuclAT_38 - -
- 1268728..1268794 + 67 NuclAT_40 - -
- 1268728..1268794 + 67 NuclAT_40 - -
- 1268728..1268794 + 67 NuclAT_40 - -
- 1268728..1268794 + 67 NuclAT_40 - -
- 1268728..1268794 + 67 NuclAT_42 - -
- 1268728..1268794 + 67 NuclAT_42 - -
- 1268728..1268794 + 67 NuclAT_42 - -
- 1268728..1268794 + 67 NuclAT_42 - -
- 1268728..1268794 + 67 NuclAT_44 - -
- 1268728..1268794 + 67 NuclAT_44 - -
- 1268728..1268794 + 67 NuclAT_44 - -
- 1268728..1268794 + 67 NuclAT_44 - -
- 1268730..1268795 + 66 NuclAT_18 - -
- 1268730..1268795 + 66 NuclAT_18 - -
- 1268730..1268795 + 66 NuclAT_18 - -
- 1268730..1268795 + 66 NuclAT_18 - -
- 1268730..1268795 + 66 NuclAT_21 - -
- 1268730..1268795 + 66 NuclAT_21 - -
- 1268730..1268795 + 66 NuclAT_21 - -
- 1268730..1268795 + 66 NuclAT_21 - -
- 1268730..1268795 + 66 NuclAT_24 - -
- 1268730..1268795 + 66 NuclAT_24 - -
- 1268730..1268795 + 66 NuclAT_24 - -
- 1268730..1268795 + 66 NuclAT_24 - -
- 1268730..1268795 + 66 NuclAT_27 - -
- 1268730..1268795 + 66 NuclAT_27 - -
- 1268730..1268795 + 66 NuclAT_27 - -
- 1268730..1268795 + 66 NuclAT_27 - -
- 1268730..1268795 + 66 NuclAT_30 - -
- 1268730..1268795 + 66 NuclAT_30 - -
- 1268730..1268795 + 66 NuclAT_30 - -
- 1268730..1268795 + 66 NuclAT_30 - -
- 1268730..1268795 + 66 NuclAT_33 - -
- 1268730..1268795 + 66 NuclAT_33 - -
- 1268730..1268795 + 66 NuclAT_33 - -
- 1268730..1268795 + 66 NuclAT_33 - -
H9446_RS06190 1269108..1269215 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1269263..1269330 + 68 NuclAT_17 - Antitoxin
- 1269263..1269330 + 68 NuclAT_17 - Antitoxin
- 1269263..1269330 + 68 NuclAT_17 - Antitoxin
- 1269263..1269330 + 68 NuclAT_17 - Antitoxin
- 1269263..1269330 + 68 NuclAT_20 - Antitoxin
- 1269263..1269330 + 68 NuclAT_20 - Antitoxin
- 1269263..1269330 + 68 NuclAT_20 - Antitoxin
- 1269263..1269330 + 68 NuclAT_20 - Antitoxin
- 1269263..1269330 + 68 NuclAT_23 - Antitoxin
- 1269263..1269330 + 68 NuclAT_23 - Antitoxin
- 1269263..1269330 + 68 NuclAT_23 - Antitoxin
- 1269263..1269330 + 68 NuclAT_23 - Antitoxin
- 1269263..1269330 + 68 NuclAT_26 - Antitoxin
- 1269263..1269330 + 68 NuclAT_26 - Antitoxin
- 1269263..1269330 + 68 NuclAT_26 - Antitoxin
- 1269263..1269330 + 68 NuclAT_26 - Antitoxin
- 1269263..1269330 + 68 NuclAT_29 - Antitoxin
- 1269263..1269330 + 68 NuclAT_29 - Antitoxin
- 1269263..1269330 + 68 NuclAT_29 - Antitoxin
- 1269263..1269330 + 68 NuclAT_29 - Antitoxin
- 1269263..1269330 + 68 NuclAT_32 - Antitoxin
- 1269263..1269330 + 68 NuclAT_32 - Antitoxin
- 1269263..1269330 + 68 NuclAT_32 - Antitoxin
- 1269263..1269330 + 68 NuclAT_32 - Antitoxin
- 1269264..1269329 + 66 NuclAT_35 - -
- 1269264..1269329 + 66 NuclAT_35 - -
- 1269264..1269329 + 66 NuclAT_35 - -
- 1269264..1269329 + 66 NuclAT_35 - -
- 1269264..1269329 + 66 NuclAT_37 - -
- 1269264..1269329 + 66 NuclAT_37 - -
- 1269264..1269329 + 66 NuclAT_37 - -
- 1269264..1269329 + 66 NuclAT_37 - -
- 1269264..1269329 + 66 NuclAT_39 - -
- 1269264..1269329 + 66 NuclAT_39 - -
- 1269264..1269329 + 66 NuclAT_39 - -
- 1269264..1269329 + 66 NuclAT_39 - -
- 1269264..1269329 + 66 NuclAT_41 - -
- 1269264..1269329 + 66 NuclAT_41 - -
- 1269264..1269329 + 66 NuclAT_41 - -
- 1269264..1269329 + 66 NuclAT_41 - -
- 1269264..1269329 + 66 NuclAT_43 - -
- 1269264..1269329 + 66 NuclAT_43 - -
- 1269264..1269329 + 66 NuclAT_43 - -
- 1269264..1269329 + 66 NuclAT_43 - -
- 1269264..1269329 + 66 NuclAT_45 - -
- 1269264..1269329 + 66 NuclAT_45 - -
- 1269264..1269329 + 66 NuclAT_45 - -
- 1269264..1269329 + 66 NuclAT_45 - -
H9446_RS06195 1269643..1269750 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1269798..1269865 + 68 NuclAT_16 - -
- 1269798..1269865 + 68 NuclAT_16 - -
- 1269798..1269865 + 68 NuclAT_16 - -
- 1269798..1269865 + 68 NuclAT_16 - -
- 1269798..1269865 + 68 NuclAT_19 - -
- 1269798..1269865 + 68 NuclAT_19 - -
- 1269798..1269865 + 68 NuclAT_19 - -
- 1269798..1269865 + 68 NuclAT_19 - -
- 1269798..1269865 + 68 NuclAT_22 - -
- 1269798..1269865 + 68 NuclAT_22 - -
- 1269798..1269865 + 68 NuclAT_22 - -
- 1269798..1269865 + 68 NuclAT_22 - -
- 1269798..1269865 + 68 NuclAT_25 - -
- 1269798..1269865 + 68 NuclAT_25 - -
- 1269798..1269865 + 68 NuclAT_25 - -
- 1269798..1269865 + 68 NuclAT_25 - -
- 1269798..1269865 + 68 NuclAT_28 - -
- 1269798..1269865 + 68 NuclAT_28 - -
- 1269798..1269865 + 68 NuclAT_28 - -
- 1269798..1269865 + 68 NuclAT_28 - -
- 1269798..1269865 + 68 NuclAT_31 - -
- 1269798..1269865 + 68 NuclAT_31 - -
- 1269798..1269865 + 68 NuclAT_31 - -
- 1269798..1269865 + 68 NuclAT_31 - -
H9446_RS06200 1270154..1271254 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
H9446_RS06205 1271524..1271754 + 231 WP_001146444.1 putative cation transport regulator ChaB -
H9446_RS06210 1271912..1272607 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
H9446_RS06215 1272651..1273004 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T170768 WP_000170963.1 NZ_CP060708:c1269215-1269108 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T170768 NZ_CP077700:c117424-117008 [Salmonella enterica subsp. enterica]
GTGAACAAAACGTATATGCTGGATACCAATATCTGCTCATTCATCATGCGTGAGCAGCCGAAGGCCGTGATCAGACGCTT
AGAGCAAGCGGTGCTGCGCAACCATCGCATCGTGGTCTCCGCTATTACCTACGCCGAAATGCGCTTCGGTGCTATCGGGA
AAAAGGCCTCGCCCCGTCATGGCCAACTGGTCGATGCGTTCTGCGCCCGCCTCGATGCGATTCTGCCGTGGGACCGTGCC
GCAGTCGATGCCACTGTAGAGGTCAAAGCAGCACTAACCGCAGCCGGTACACCCATCGGTCCCAACGACACAGCGATTGC
CGGACATGCTATAGCTGCAGGGGCCATTCTGGTGACCAATAATACGCGAGAGTTTGAGCGGGTGCCAAATTTGGTATTAG
AAGACTGGGTTAAATAA

Antitoxin


Download         Length: 68 bp

>AT170768 NZ_CP060708:1269263-1269330 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References