Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 437559..437743 | Replicon | chromosome |
Accession | NZ_CP060491 | ||
Organism | Staphylococcus aureus strain WH39 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | H8N04_RS02080 | Protein ID | WP_000482650.1 |
Coordinates | 437559..437666 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 437683..437743 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H8N04_RS02055 | 432922..433395 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
H8N04_RS02060 | 433518..434729 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
H8N04_RS02065 | 434911..435570 | - | 660 | WP_000831298.1 | membrane protein | - |
H8N04_RS02070 | 435630..436772 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
H8N04_RS02075 | 437040..437426 | + | 387 | WP_000779358.1 | flippase GtxA | - |
H8N04_RS02080 | 437559..437666 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 437683..437743 | - | 61 | - | - | Antitoxin |
H8N04_RS02085 | 438294..440057 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
H8N04_RS02090 | 440082..441815 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
H8N04_RS02095 | 442046..442213 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T170456 WP_000482650.1 NZ_CP060491:437559-437666 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T170456 NZ_CP077392:2779767-2779870 [Enterobacter hormaechei]
GGCAAGGCGATTGAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTGAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT170456 NZ_CP060491:c437743-437683 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|