Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1226479..1226699 | Replicon | chromosome |
Accession | NZ_CP060121 | ||
Organism | Escherichia coli BL21 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | E3PKK3 |
Locus tag | FFHJCLDM_RS06000 | Protein ID | WP_000170951.1 |
Coordinates | 1226479..1226586 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1226636..1226699 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FFHJCLDM_RS05975 | 1222325..1223407 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
FFHJCLDM_RS05980 | 1223407..1224240 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
FFHJCLDM_RS05985 | 1224237..1224629 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
FFHJCLDM_RS05990 | 1224633..1225442 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
FFHJCLDM_RS05995 | 1225478..1226332 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
FFHJCLDM_RS06000 | 1226479..1226586 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1226636..1226699 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_50 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_50 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_50 | - | Antitoxin |
- | 1226636..1226699 | + | 64 | NuclAT_50 | - | Antitoxin |
FFHJCLDM_RS06005 | 1227014..1227121 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
- | 1227169..1227234 | + | 66 | NuclAT_30 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_30 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_30 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_30 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_33 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_33 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_33 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_33 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_36 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_36 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_36 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_36 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_39 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_39 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_39 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_39 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_45 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_45 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_45 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_45 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_48 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_48 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_48 | - | - |
- | 1227169..1227234 | + | 66 | NuclAT_48 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_16 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_16 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_16 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_16 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_18 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_18 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_18 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_18 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_20 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_20 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_20 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_20 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_22 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_22 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_22 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_22 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_24 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_24 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_24 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_24 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_26 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_26 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_26 | - | - |
- | 1227169..1227236 | + | 68 | NuclAT_26 | - | - |
FFHJCLDM_RS06010 | 1227549..1227656 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1227704..1227769 | + | 66 | NuclAT_31 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_31 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_31 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_31 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_34 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_34 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_34 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_34 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_37 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_37 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_37 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_37 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_40 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_40 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_40 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_40 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_46 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_46 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_46 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_46 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_49 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_49 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_49 | - | - |
- | 1227704..1227769 | + | 66 | NuclAT_49 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_15 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_15 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_15 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_15 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_17 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_17 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_17 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_17 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_19 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_19 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_19 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_19 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_21 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_21 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_21 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_21 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_23 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_23 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_23 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_23 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_25 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_25 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_25 | - | - |
- | 1227704..1227771 | + | 68 | NuclAT_25 | - | - |
FFHJCLDM_RS06015 | 1228061..1229161 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
FFHJCLDM_RS06020 | 1229431..1229661 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
FFHJCLDM_RS06025 | 1229819..1230514 | + | 696 | WP_012775986.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
FFHJCLDM_RS06030 | 1230558..1230911 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T170002 WP_000170951.1 NZ_CP060121:c1226586-1226479 [Escherichia coli BL21]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T170002 NZ_CP076853:2064549-2064839 [Rhizobium sp. WYJ-E13]
ATGCCACAAGTAGTCTTTTCGCCGGCAGCGATCCGCGACCTGCAACGGCTGCGGGATTTGCTGACGCCGAAAAACCCCTC
GGCAGCAAGGCGAGCGGGGGAAACGATCCTCGCAGGTGTCAGAACGCTCTGCCTGCATCCGCATATGGGCCGCCTGATCG
AGGACCTGCCCGAGCAATACCGCGAATGGCTCATCGATTTCGGAGACAGCGGATATGTGGCCCGCTACCGCTTCGATCAG
AACACAGTCACGATCCTTGCGGTGCGGCACCAGAAGGAAGCAATGTTCTGA
ATGCCACAAGTAGTCTTTTCGCCGGCAGCGATCCGCGACCTGCAACGGCTGCGGGATTTGCTGACGCCGAAAAACCCCTC
GGCAGCAAGGCGAGCGGGGGAAACGATCCTCGCAGGTGTCAGAACGCTCTGCCTGCATCCGCATATGGGCCGCCTGATCG
AGGACCTGCCCGAGCAATACCGCGAATGGCTCATCGATTTCGGAGACAGCGGATATGTGGCCCGCTACCGCTTCGATCAG
AACACAGTCACGATCCTTGCGGTGCGGCACCAGAAGGAAGCAATGTTCTGA
Antitoxin
Download Length: 64 bp
>AT170002 NZ_CP060121:1226636-1226699 [Escherichia coli BL21]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|