Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2651894..2652114 | Replicon | chromosome |
| Accession | NZ_CP059947 | ||
| Organism | Escherichia coli strain 268.2 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | H5C70_RS12690 | Protein ID | WP_000170965.1 |
| Coordinates | 2652007..2652114 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2651894..2651960 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H5C70_RS12665 | 2647173..2648567 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
| H5C70_RS12670 | 2648752..2649105 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| H5C70_RS12675 | 2649149..2649844 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| H5C70_RS12680 | 2650002..2650232 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| H5C70_RS12685 | 2650502..2651602 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2651894..2651960 | - | 67 | - | - | Antitoxin |
| H5C70_RS12690 | 2652007..2652114 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2652427..2652490 | - | 64 | NuclAT_33 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_33 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_33 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_33 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_36 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_36 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_36 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_36 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_39 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_39 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_39 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_39 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_42 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_42 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_42 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_42 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_45 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_45 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_45 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_45 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_48 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_48 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_48 | - | - |
| - | 2652427..2652490 | - | 64 | NuclAT_48 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_50 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_50 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_50 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_50 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_53 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_53 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_53 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_53 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_56 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_56 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_56 | - | - |
| - | 2652428..2652490 | - | 63 | NuclAT_56 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_15 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_15 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_15 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_15 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_18 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_18 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_18 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_18 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_21 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_21 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_21 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_21 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_24 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_24 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_24 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_24 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_27 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_27 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_27 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_27 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_30 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_30 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_30 | - | - |
| - | 2652429..2652490 | - | 62 | NuclAT_30 | - | - |
| H5C70_RS12695 | 2652543..2652650 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2652963..2653028 | - | 66 | NuclAT_32 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_32 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_32 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_32 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_35 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_35 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_35 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_35 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_38 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_38 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_38 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_38 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_41 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_41 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_41 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_41 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_44 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_44 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_44 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_44 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_47 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_47 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_47 | - | - |
| - | 2652963..2653028 | - | 66 | NuclAT_47 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_49 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_49 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_49 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_49 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_52 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_52 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_52 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_52 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_55 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_55 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_55 | - | - |
| - | 2652964..2653030 | - | 67 | NuclAT_55 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_14 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_14 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_14 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_14 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_17 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_17 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_17 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_17 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_20 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_20 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_20 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_20 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_23 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_23 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_23 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_23 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_26 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_26 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_26 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_26 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_29 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_29 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_29 | - | - |
| - | 2652965..2653028 | - | 64 | NuclAT_29 | - | - |
| H5C70_RS12700 | 2653078..2653185 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| H5C70_RS12705 | 2653334..2654188 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| H5C70_RS12710 | 2654224..2655033 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| H5C70_RS12715 | 2655037..2655429 | - | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| H5C70_RS12720 | 2655426..2656259 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T169473 WP_000170965.1 NZ_CP059947:2652007-2652114 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T169473 NZ_CP076499:c17618-17472 [Enterococcus faecalis]
ATGAACGTACTTCCAAAATCTATAGAAAGGAGAAGCCTTTTGTCCGTTTCGGAAAGTTTGCAACTAATGCTTGCGTTTGG
TGGGTTTACATTGACCCTAATCACAACCATTGTTGCCATTCTGAACTATAAAGACAAAAAGAAATAA
ATGAACGTACTTCCAAAATCTATAGAAAGGAGAAGCCTTTTGTCCGTTTCGGAAAGTTTGCAACTAATGCTTGCGTTTGG
TGGGTTTACATTGACCCTAATCACAACCATTGTTGCCATTCTGAACTATAAAGACAAAAAGAAATAA
Antitoxin
Download Length: 67 bp
>AT169473 NZ_CP059947:c2651960-2651894 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|