Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2651894..2652114 Replicon chromosome
Accession NZ_CP059947
Organism Escherichia coli strain 268.2

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag H5C70_RS12690 Protein ID WP_000170965.1
Coordinates 2652007..2652114 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2651894..2651960 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H5C70_RS12665 2647173..2648567 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
H5C70_RS12670 2648752..2649105 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
H5C70_RS12675 2649149..2649844 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H5C70_RS12680 2650002..2650232 - 231 WP_001146442.1 putative cation transport regulator ChaB -
H5C70_RS12685 2650502..2651602 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2651894..2651960 - 67 - - Antitoxin
H5C70_RS12690 2652007..2652114 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2652427..2652490 - 64 NuclAT_33 - -
- 2652427..2652490 - 64 NuclAT_33 - -
- 2652427..2652490 - 64 NuclAT_33 - -
- 2652427..2652490 - 64 NuclAT_33 - -
- 2652427..2652490 - 64 NuclAT_36 - -
- 2652427..2652490 - 64 NuclAT_36 - -
- 2652427..2652490 - 64 NuclAT_36 - -
- 2652427..2652490 - 64 NuclAT_36 - -
- 2652427..2652490 - 64 NuclAT_39 - -
- 2652427..2652490 - 64 NuclAT_39 - -
- 2652427..2652490 - 64 NuclAT_39 - -
- 2652427..2652490 - 64 NuclAT_39 - -
- 2652427..2652490 - 64 NuclAT_42 - -
- 2652427..2652490 - 64 NuclAT_42 - -
- 2652427..2652490 - 64 NuclAT_42 - -
- 2652427..2652490 - 64 NuclAT_42 - -
- 2652427..2652490 - 64 NuclAT_45 - -
- 2652427..2652490 - 64 NuclAT_45 - -
- 2652427..2652490 - 64 NuclAT_45 - -
- 2652427..2652490 - 64 NuclAT_45 - -
- 2652427..2652490 - 64 NuclAT_48 - -
- 2652427..2652490 - 64 NuclAT_48 - -
- 2652427..2652490 - 64 NuclAT_48 - -
- 2652427..2652490 - 64 NuclAT_48 - -
- 2652428..2652490 - 63 NuclAT_50 - -
- 2652428..2652490 - 63 NuclAT_50 - -
- 2652428..2652490 - 63 NuclAT_50 - -
- 2652428..2652490 - 63 NuclAT_50 - -
- 2652428..2652490 - 63 NuclAT_53 - -
- 2652428..2652490 - 63 NuclAT_53 - -
- 2652428..2652490 - 63 NuclAT_53 - -
- 2652428..2652490 - 63 NuclAT_53 - -
- 2652428..2652490 - 63 NuclAT_56 - -
- 2652428..2652490 - 63 NuclAT_56 - -
- 2652428..2652490 - 63 NuclAT_56 - -
- 2652428..2652490 - 63 NuclAT_56 - -
- 2652429..2652490 - 62 NuclAT_15 - -
- 2652429..2652490 - 62 NuclAT_15 - -
- 2652429..2652490 - 62 NuclAT_15 - -
- 2652429..2652490 - 62 NuclAT_15 - -
- 2652429..2652490 - 62 NuclAT_18 - -
- 2652429..2652490 - 62 NuclAT_18 - -
- 2652429..2652490 - 62 NuclAT_18 - -
- 2652429..2652490 - 62 NuclAT_18 - -
- 2652429..2652490 - 62 NuclAT_21 - -
- 2652429..2652490 - 62 NuclAT_21 - -
- 2652429..2652490 - 62 NuclAT_21 - -
- 2652429..2652490 - 62 NuclAT_21 - -
- 2652429..2652490 - 62 NuclAT_24 - -
- 2652429..2652490 - 62 NuclAT_24 - -
- 2652429..2652490 - 62 NuclAT_24 - -
- 2652429..2652490 - 62 NuclAT_24 - -
- 2652429..2652490 - 62 NuclAT_27 - -
- 2652429..2652490 - 62 NuclAT_27 - -
- 2652429..2652490 - 62 NuclAT_27 - -
- 2652429..2652490 - 62 NuclAT_27 - -
- 2652429..2652490 - 62 NuclAT_30 - -
- 2652429..2652490 - 62 NuclAT_30 - -
- 2652429..2652490 - 62 NuclAT_30 - -
- 2652429..2652490 - 62 NuclAT_30 - -
H5C70_RS12695 2652543..2652650 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2652963..2653028 - 66 NuclAT_32 - -
- 2652963..2653028 - 66 NuclAT_32 - -
- 2652963..2653028 - 66 NuclAT_32 - -
- 2652963..2653028 - 66 NuclAT_32 - -
- 2652963..2653028 - 66 NuclAT_35 - -
- 2652963..2653028 - 66 NuclAT_35 - -
- 2652963..2653028 - 66 NuclAT_35 - -
- 2652963..2653028 - 66 NuclAT_35 - -
- 2652963..2653028 - 66 NuclAT_38 - -
- 2652963..2653028 - 66 NuclAT_38 - -
- 2652963..2653028 - 66 NuclAT_38 - -
- 2652963..2653028 - 66 NuclAT_38 - -
- 2652963..2653028 - 66 NuclAT_41 - -
- 2652963..2653028 - 66 NuclAT_41 - -
- 2652963..2653028 - 66 NuclAT_41 - -
- 2652963..2653028 - 66 NuclAT_41 - -
- 2652963..2653028 - 66 NuclAT_44 - -
- 2652963..2653028 - 66 NuclAT_44 - -
- 2652963..2653028 - 66 NuclAT_44 - -
- 2652963..2653028 - 66 NuclAT_44 - -
- 2652963..2653028 - 66 NuclAT_47 - -
- 2652963..2653028 - 66 NuclAT_47 - -
- 2652963..2653028 - 66 NuclAT_47 - -
- 2652963..2653028 - 66 NuclAT_47 - -
- 2652964..2653030 - 67 NuclAT_49 - -
- 2652964..2653030 - 67 NuclAT_49 - -
- 2652964..2653030 - 67 NuclAT_49 - -
- 2652964..2653030 - 67 NuclAT_49 - -
- 2652964..2653030 - 67 NuclAT_52 - -
- 2652964..2653030 - 67 NuclAT_52 - -
- 2652964..2653030 - 67 NuclAT_52 - -
- 2652964..2653030 - 67 NuclAT_52 - -
- 2652964..2653030 - 67 NuclAT_55 - -
- 2652964..2653030 - 67 NuclAT_55 - -
- 2652964..2653030 - 67 NuclAT_55 - -
- 2652964..2653030 - 67 NuclAT_55 - -
- 2652965..2653028 - 64 NuclAT_14 - -
- 2652965..2653028 - 64 NuclAT_14 - -
- 2652965..2653028 - 64 NuclAT_14 - -
- 2652965..2653028 - 64 NuclAT_14 - -
- 2652965..2653028 - 64 NuclAT_17 - -
- 2652965..2653028 - 64 NuclAT_17 - -
- 2652965..2653028 - 64 NuclAT_17 - -
- 2652965..2653028 - 64 NuclAT_17 - -
- 2652965..2653028 - 64 NuclAT_20 - -
- 2652965..2653028 - 64 NuclAT_20 - -
- 2652965..2653028 - 64 NuclAT_20 - -
- 2652965..2653028 - 64 NuclAT_20 - -
- 2652965..2653028 - 64 NuclAT_23 - -
- 2652965..2653028 - 64 NuclAT_23 - -
- 2652965..2653028 - 64 NuclAT_23 - -
- 2652965..2653028 - 64 NuclAT_23 - -
- 2652965..2653028 - 64 NuclAT_26 - -
- 2652965..2653028 - 64 NuclAT_26 - -
- 2652965..2653028 - 64 NuclAT_26 - -
- 2652965..2653028 - 64 NuclAT_26 - -
- 2652965..2653028 - 64 NuclAT_29 - -
- 2652965..2653028 - 64 NuclAT_29 - -
- 2652965..2653028 - 64 NuclAT_29 - -
- 2652965..2653028 - 64 NuclAT_29 - -
H5C70_RS12700 2653078..2653185 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
H5C70_RS12705 2653334..2654188 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H5C70_RS12710 2654224..2655033 - 810 WP_001257044.1 invasion regulator SirB1 -
H5C70_RS12715 2655037..2655429 - 393 WP_000200392.1 invasion regulator SirB2 -
H5C70_RS12720 2655426..2656259 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T169473 WP_000170965.1 NZ_CP059947:2652007-2652114 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T169473 NZ_CP076499:c17618-17472 [Enterococcus faecalis]
ATGAACGTACTTCCAAAATCTATAGAAAGGAGAAGCCTTTTGTCCGTTTCGGAAAGTTTGCAACTAATGCTTGCGTTTGG
TGGGTTTACATTGACCCTAATCACAACCATTGTTGCCATTCTGAACTATAAAGACAAAAAGAAATAA

Antitoxin


Download         Length: 67 bp

>AT169473 NZ_CP059947:c2651960-2651894 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References