Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 5012330..5012551 Replicon chromosome
Accession NZ_CP059835
Organism Escherichia coli strain tcmA_3

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag GQF93_RS24375 Protein ID WP_000170926.1
Coordinates 5012330..5012437 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 5012490..5012551 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GQF93_RS24345 (5007639) 5007639..5008721 + 1083 WP_000804726.1 peptide chain release factor 1 -
GQF93_RS24350 (5008721) 5008721..5009554 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
GQF93_RS24355 (5009551) 5009551..5009943 + 393 WP_000200378.1 invasion regulator SirB2 -
GQF93_RS24360 (5009947) 5009947..5010756 + 810 WP_001257044.1 invasion regulator SirB1 -
GQF93_RS24365 (5010792) 5010792..5011646 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
GQF93_RS24370 (5011795) 5011795..5011902 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (5011952) 5011952..5012015 + 64 NuclAT_15 - -
- (5011952) 5011952..5012015 + 64 NuclAT_15 - -
- (5011952) 5011952..5012015 + 64 NuclAT_15 - -
- (5011952) 5011952..5012015 + 64 NuclAT_15 - -
- (5011952) 5011952..5012015 + 64 NuclAT_18 - -
- (5011952) 5011952..5012015 + 64 NuclAT_18 - -
- (5011952) 5011952..5012015 + 64 NuclAT_18 - -
- (5011952) 5011952..5012015 + 64 NuclAT_18 - -
- (5011952) 5011952..5012015 + 64 NuclAT_21 - -
- (5011952) 5011952..5012015 + 64 NuclAT_21 - -
- (5011952) 5011952..5012015 + 64 NuclAT_21 - -
- (5011952) 5011952..5012015 + 64 NuclAT_21 - -
- (5011952) 5011952..5012015 + 64 NuclAT_24 - -
- (5011952) 5011952..5012015 + 64 NuclAT_24 - -
- (5011952) 5011952..5012015 + 64 NuclAT_24 - -
- (5011952) 5011952..5012015 + 64 NuclAT_24 - -
- (5011952) 5011952..5012015 + 64 NuclAT_27 - -
- (5011952) 5011952..5012015 + 64 NuclAT_27 - -
- (5011952) 5011952..5012015 + 64 NuclAT_27 - -
- (5011952) 5011952..5012015 + 64 NuclAT_27 - -
- (5011952) 5011952..5012015 + 64 NuclAT_30 - -
- (5011952) 5011952..5012015 + 64 NuclAT_30 - -
- (5011952) 5011952..5012015 + 64 NuclAT_30 - -
- (5011952) 5011952..5012015 + 64 NuclAT_30 - -
- (5011950) 5011950..5012016 + 67 NuclAT_43 - -
- (5011950) 5011950..5012016 + 67 NuclAT_43 - -
- (5011950) 5011950..5012016 + 67 NuclAT_43 - -
- (5011950) 5011950..5012016 + 67 NuclAT_43 - -
- (5011950) 5011950..5012016 + 67 NuclAT_46 - -
- (5011950) 5011950..5012016 + 67 NuclAT_46 - -
- (5011950) 5011950..5012016 + 67 NuclAT_46 - -
- (5011950) 5011950..5012016 + 67 NuclAT_46 - -
- (5011950) 5011950..5012016 + 67 NuclAT_49 - -
- (5011950) 5011950..5012016 + 67 NuclAT_49 - -
- (5011950) 5011950..5012016 + 67 NuclAT_49 - -
- (5011950) 5011950..5012016 + 67 NuclAT_49 - -
- (5011950) 5011950..5012016 + 67 NuclAT_52 - -
- (5011950) 5011950..5012016 + 67 NuclAT_52 - -
- (5011950) 5011950..5012016 + 67 NuclAT_52 - -
- (5011950) 5011950..5012016 + 67 NuclAT_52 - -
GQF93_RS24375 (5012330) 5012330..5012437 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5012490) 5012490..5012551 + 62 NuclAT_14 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_14 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_14 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_14 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_17 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_17 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_17 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_17 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_20 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_20 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_20 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_20 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_23 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_23 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_23 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_23 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_26 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_26 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_26 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_26 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_29 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_29 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_29 - Antitoxin
- (5012490) 5012490..5012551 + 62 NuclAT_29 - Antitoxin
- (5012490) 5012490..5012552 + 63 NuclAT_44 - -
- (5012490) 5012490..5012552 + 63 NuclAT_44 - -
- (5012490) 5012490..5012552 + 63 NuclAT_44 - -
- (5012490) 5012490..5012552 + 63 NuclAT_44 - -
- (5012490) 5012490..5012552 + 63 NuclAT_47 - -
- (5012490) 5012490..5012552 + 63 NuclAT_47 - -
- (5012490) 5012490..5012552 + 63 NuclAT_47 - -
- (5012490) 5012490..5012552 + 63 NuclAT_47 - -
- (5012490) 5012490..5012552 + 63 NuclAT_50 - -
- (5012490) 5012490..5012552 + 63 NuclAT_50 - -
- (5012490) 5012490..5012552 + 63 NuclAT_50 - -
- (5012490) 5012490..5012552 + 63 NuclAT_50 - -
- (5012490) 5012490..5012552 + 63 NuclAT_53 - -
- (5012490) 5012490..5012552 + 63 NuclAT_53 - -
- (5012490) 5012490..5012552 + 63 NuclAT_53 - -
- (5012490) 5012490..5012552 + 63 NuclAT_53 - -
- (5012490) 5012490..5012553 + 64 NuclAT_32 - -
- (5012490) 5012490..5012553 + 64 NuclAT_32 - -
- (5012490) 5012490..5012553 + 64 NuclAT_32 - -
- (5012490) 5012490..5012553 + 64 NuclAT_32 - -
- (5012490) 5012490..5012553 + 64 NuclAT_34 - -
- (5012490) 5012490..5012553 + 64 NuclAT_34 - -
- (5012490) 5012490..5012553 + 64 NuclAT_34 - -
- (5012490) 5012490..5012553 + 64 NuclAT_34 - -
- (5012490) 5012490..5012553 + 64 NuclAT_36 - -
- (5012490) 5012490..5012553 + 64 NuclAT_36 - -
- (5012490) 5012490..5012553 + 64 NuclAT_36 - -
- (5012490) 5012490..5012553 + 64 NuclAT_36 - -
- (5012490) 5012490..5012553 + 64 NuclAT_38 - -
- (5012490) 5012490..5012553 + 64 NuclAT_38 - -
- (5012490) 5012490..5012553 + 64 NuclAT_38 - -
- (5012490) 5012490..5012553 + 64 NuclAT_38 - -
- (5012490) 5012490..5012553 + 64 NuclAT_40 - -
- (5012490) 5012490..5012553 + 64 NuclAT_40 - -
- (5012490) 5012490..5012553 + 64 NuclAT_40 - -
- (5012490) 5012490..5012553 + 64 NuclAT_40 - -
- (5012490) 5012490..5012553 + 64 NuclAT_42 - -
- (5012490) 5012490..5012553 + 64 NuclAT_42 - -
- (5012490) 5012490..5012553 + 64 NuclAT_42 - -
- (5012490) 5012490..5012553 + 64 NuclAT_42 - -
GQF93_RS24380 (5012866) 5012866..5012973 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (5013021) 5013021..5013086 + 66 NuclAT_13 - -
- (5013021) 5013021..5013086 + 66 NuclAT_13 - -
- (5013021) 5013021..5013086 + 66 NuclAT_13 - -
- (5013021) 5013021..5013086 + 66 NuclAT_13 - -
- (5013021) 5013021..5013086 + 66 NuclAT_16 - -
- (5013021) 5013021..5013086 + 66 NuclAT_16 - -
- (5013021) 5013021..5013086 + 66 NuclAT_16 - -
- (5013021) 5013021..5013086 + 66 NuclAT_16 - -
- (5013021) 5013021..5013086 + 66 NuclAT_19 - -
- (5013021) 5013021..5013086 + 66 NuclAT_19 - -
- (5013021) 5013021..5013086 + 66 NuclAT_19 - -
- (5013021) 5013021..5013086 + 66 NuclAT_19 - -
- (5013021) 5013021..5013086 + 66 NuclAT_22 - -
- (5013021) 5013021..5013086 + 66 NuclAT_22 - -
- (5013021) 5013021..5013086 + 66 NuclAT_22 - -
- (5013021) 5013021..5013086 + 66 NuclAT_22 - -
- (5013021) 5013021..5013086 + 66 NuclAT_25 - -
- (5013021) 5013021..5013086 + 66 NuclAT_25 - -
- (5013021) 5013021..5013086 + 66 NuclAT_25 - -
- (5013021) 5013021..5013086 + 66 NuclAT_25 - -
- (5013021) 5013021..5013086 + 66 NuclAT_28 - -
- (5013021) 5013021..5013086 + 66 NuclAT_28 - -
- (5013021) 5013021..5013086 + 66 NuclAT_28 - -
- (5013021) 5013021..5013086 + 66 NuclAT_28 - -
- (5013022) 5013022..5013087 + 66 NuclAT_45 - -
- (5013022) 5013022..5013087 + 66 NuclAT_45 - -
- (5013022) 5013022..5013087 + 66 NuclAT_45 - -
- (5013022) 5013022..5013087 + 66 NuclAT_45 - -
- (5013022) 5013022..5013087 + 66 NuclAT_48 - -
- (5013022) 5013022..5013087 + 66 NuclAT_48 - -
- (5013022) 5013022..5013087 + 66 NuclAT_48 - -
- (5013022) 5013022..5013087 + 66 NuclAT_48 - -
- (5013022) 5013022..5013087 + 66 NuclAT_51 - -
- (5013022) 5013022..5013087 + 66 NuclAT_51 - -
- (5013022) 5013022..5013087 + 66 NuclAT_51 - -
- (5013022) 5013022..5013087 + 66 NuclAT_51 - -
- (5013022) 5013022..5013087 + 66 NuclAT_54 - -
- (5013022) 5013022..5013087 + 66 NuclAT_54 - -
- (5013022) 5013022..5013087 + 66 NuclAT_54 - -
- (5013022) 5013022..5013087 + 66 NuclAT_54 - -
- (5013021) 5013021..5013088 + 68 NuclAT_31 - -
- (5013021) 5013021..5013088 + 68 NuclAT_31 - -
- (5013021) 5013021..5013088 + 68 NuclAT_31 - -
- (5013021) 5013021..5013088 + 68 NuclAT_31 - -
- (5013021) 5013021..5013088 + 68 NuclAT_33 - -
- (5013021) 5013021..5013088 + 68 NuclAT_33 - -
- (5013021) 5013021..5013088 + 68 NuclAT_33 - -
- (5013021) 5013021..5013088 + 68 NuclAT_33 - -
- (5013021) 5013021..5013088 + 68 NuclAT_35 - -
- (5013021) 5013021..5013088 + 68 NuclAT_35 - -
- (5013021) 5013021..5013088 + 68 NuclAT_35 - -
- (5013021) 5013021..5013088 + 68 NuclAT_35 - -
- (5013021) 5013021..5013088 + 68 NuclAT_37 - -
- (5013021) 5013021..5013088 + 68 NuclAT_37 - -
- (5013021) 5013021..5013088 + 68 NuclAT_37 - -
- (5013021) 5013021..5013088 + 68 NuclAT_37 - -
- (5013021) 5013021..5013088 + 68 NuclAT_39 - -
- (5013021) 5013021..5013088 + 68 NuclAT_39 - -
- (5013021) 5013021..5013088 + 68 NuclAT_39 - -
- (5013021) 5013021..5013088 + 68 NuclAT_39 - -
- (5013021) 5013021..5013088 + 68 NuclAT_41 - -
- (5013021) 5013021..5013088 + 68 NuclAT_41 - -
- (5013021) 5013021..5013088 + 68 NuclAT_41 - -
- (5013021) 5013021..5013088 + 68 NuclAT_41 - -
GQF93_RS24385 (5013378) 5013378..5014478 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
GQF93_RS24390 (5014748) 5014748..5014978 + 231 WP_001146442.1 putative cation transport regulator ChaB -
GQF93_RS24395 (5015136) 5015136..5015831 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
GQF93_RS24400 (5015875) 5015875..5016228 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T169205 WP_000170926.1 NZ_CP059835:c5012437-5012330 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T169205 NZ_CP076301:4396976-4397896 [Escherichia coli]
ATGGATCTGCGTGATAGCTATGCCCGGCAGGTCAAACTGTTGATGGCCGCTCTGCCGTATGTGGCGAAGGAGTCCTGTTT
CGCGTTGAAAGGCGGCACCGCAATCAATTTGTTTGTGCAGGATTTTCCCCGTCTGTCGGTGGATATTGATCTGGCGTATA
AGAGCTTTGCGGATCGCGATACTGATCTGGCGGCTATCAACGACGCTTTGAAGAGGATTACTGCATCGCTGAACGGCAGA
CCGGGGATCACCGCGATTCGGCAGGAAAATAAAGCGGATGAAAAGCGCATCATTGTGAATACCGCTGATGCAAAGATTAA
GATCGAGGTTAGCCCGGTCTGGCGCGGGCTGTTGTTGCCTCCGGCAGAAATGCCTGTGTGCGAACGTGTGGAAATGGAGT
ATGGCTTCACCACCATGAGTGTCGTCTCGCTGGCGGATCTTTATGGCGGTAAAATCTGCGCAGCGCTTGATCGTCAGCAC
CCGCGCGATCTGTTTGATGTGCTGAATATGCTGGAGAAACCGGGACTGATGCGGGAGATCTTTGACGGTTTTCTTTGTTA
TCTGGCAGGCCATCCCCGCCCCATTGCCGAGTTGCTGGCCCCAAACTGGGATACAGAGCGGATCACGACGCTGTATGCTC
AGGAATTTTCGGGGATGACTCAGCAGGAAACGTCGCTGGAATCGCTGCTGTCAGTAACGACTTTGCTGCCGCAGGCGTTG
AAGTCACATCTTACGGATCTGGATCGCGAGTTCTTGCTCAGTTTTAAGCAAAACAGCCCTGACTGGTCGCGGTATCGCTA
TCCTGAAATTCAGCATCTTCCGGCTATTCGCTGGAAGCAACGTAATCTGGCGGTGCTGAAAGATAAAAATCCGGCGAAGT
ATGTGGCGGCGGTGAATAAGCTAGAGAGGGTGCTGGCGTAA

Antitoxin


Download         Length: 62 bp

>AT169205 NZ_CP059835:5012490-5012551 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9

Antitoxin

Download structure file

References