Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 73731..74157 | Replicon | plasmid pSY3626_124k |
Accession | NZ_CP059285 | ||
Organism | Escherichia coli strain SY3626_hybrid |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | H0155_RS23955 | Protein ID | WP_001312861.1 |
Coordinates | 73731..73889 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 73933..74157 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H0155_RS23930 | 69100..69789 | - | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
H0155_RS23935 | 69976..70359 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
H0155_RS23940 | 70680..71282 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
H0155_RS23945 | 71579..72400 | - | 822 | WP_072795862.1 | DUF945 domain-containing protein | - |
H0155_RS23950 | 72522..72809 | - | 288 | WP_000107535.1 | hypothetical protein | - |
H0155_RS23955 | 73731..73889 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 73933..74157 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 73933..74157 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 73933..74157 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 73933..74157 | - | 225 | NuclAT_0 | - | Antitoxin |
H0155_RS23960 | 73969..74157 | + | 189 | WP_001299721.1 | hypothetical protein | - |
H0155_RS23965 | 74169..74888 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
H0155_RS23970 | 74885..75319 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
H0155_RS23975 | 75374..77332 | - | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
H0155_RS23980 | 77397..77630 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
H0155_RS23985 | 77687..78226 | - | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
H0155_RS23990 | 78252..78458 | - | 207 | WP_000275853.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(M) / ant(3'')-Ia / aac(3)-IId / lnu(F) / blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR | - | 1..124445 | 124445 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T168518 WP_001312861.1 NZ_CP059285:c73889-73731 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T168518 NZ_CP076043:1553923-1554030 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 225 bp
>AT168518 NZ_CP059285:c74157-73933 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|