Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2914560..2914781 Replicon chromosome
Accession NZ_CP059281
Organism Escherichia coli strain C9

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag H0272_RS14235 Protein ID WP_001531632.1
Coordinates 2914560..2914667 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2914715..2914781 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H0272_RS14210 2910404..2911486 + 1083 WP_000804726.1 peptide chain release factor 1 -
H0272_RS14215 2911486..2912319 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
H0272_RS14220 2912316..2912708 + 393 WP_000200375.1 invasion regulator SirB2 -
H0272_RS14225 2912712..2913521 + 810 WP_001257044.1 invasion regulator SirB1 -
H0272_RS14230 2913557..2914411 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H0272_RS14235 2914560..2914667 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2914715..2914781 + 67 NuclAT_10 - Antitoxin
- 2914715..2914781 + 67 NuclAT_10 - Antitoxin
- 2914715..2914781 + 67 NuclAT_10 - Antitoxin
- 2914715..2914781 + 67 NuclAT_10 - Antitoxin
- 2914715..2914781 + 67 NuclAT_11 - Antitoxin
- 2914715..2914781 + 67 NuclAT_11 - Antitoxin
- 2914715..2914781 + 67 NuclAT_11 - Antitoxin
- 2914715..2914781 + 67 NuclAT_11 - Antitoxin
- 2914715..2914781 + 67 NuclAT_12 - Antitoxin
- 2914715..2914781 + 67 NuclAT_12 - Antitoxin
- 2914715..2914781 + 67 NuclAT_12 - Antitoxin
- 2914715..2914781 + 67 NuclAT_12 - Antitoxin
- 2914715..2914781 + 67 NuclAT_7 - Antitoxin
- 2914715..2914781 + 67 NuclAT_7 - Antitoxin
- 2914715..2914781 + 67 NuclAT_7 - Antitoxin
- 2914715..2914781 + 67 NuclAT_7 - Antitoxin
- 2914715..2914781 + 67 NuclAT_8 - Antitoxin
- 2914715..2914781 + 67 NuclAT_8 - Antitoxin
- 2914715..2914781 + 67 NuclAT_8 - Antitoxin
- 2914715..2914781 + 67 NuclAT_8 - Antitoxin
- 2914715..2914781 + 67 NuclAT_9 - Antitoxin
- 2914715..2914781 + 67 NuclAT_9 - Antitoxin
- 2914715..2914781 + 67 NuclAT_9 - Antitoxin
- 2914715..2914781 + 67 NuclAT_9 - Antitoxin
- 2914717..2914780 + 64 NuclAT_14 - -
- 2914717..2914780 + 64 NuclAT_14 - -
- 2914717..2914780 + 64 NuclAT_14 - -
- 2914717..2914780 + 64 NuclAT_14 - -
- 2914717..2914780 + 64 NuclAT_15 - -
- 2914717..2914780 + 64 NuclAT_15 - -
- 2914717..2914780 + 64 NuclAT_15 - -
- 2914717..2914780 + 64 NuclAT_15 - -
- 2914717..2914780 + 64 NuclAT_16 - -
- 2914717..2914780 + 64 NuclAT_16 - -
- 2914717..2914780 + 64 NuclAT_16 - -
- 2914717..2914780 + 64 NuclAT_16 - -
- 2914717..2914780 + 64 NuclAT_17 - -
- 2914717..2914780 + 64 NuclAT_17 - -
- 2914717..2914780 + 64 NuclAT_17 - -
- 2914717..2914780 + 64 NuclAT_17 - -
- 2914717..2914780 + 64 NuclAT_18 - -
- 2914717..2914780 + 64 NuclAT_18 - -
- 2914717..2914780 + 64 NuclAT_18 - -
- 2914717..2914780 + 64 NuclAT_18 - -
- 2914717..2914780 + 64 NuclAT_19 - -
- 2914717..2914780 + 64 NuclAT_19 - -
- 2914717..2914780 + 64 NuclAT_19 - -
- 2914717..2914780 + 64 NuclAT_19 - -
- 2914717..2914782 + 66 NuclAT_20 - -
- 2914717..2914782 + 66 NuclAT_20 - -
- 2914717..2914782 + 66 NuclAT_20 - -
- 2914717..2914782 + 66 NuclAT_20 - -
- 2914717..2914782 + 66 NuclAT_21 - -
- 2914717..2914782 + 66 NuclAT_21 - -
- 2914717..2914782 + 66 NuclAT_21 - -
- 2914717..2914782 + 66 NuclAT_21 - -
- 2914717..2914782 + 66 NuclAT_22 - -
- 2914717..2914782 + 66 NuclAT_22 - -
- 2914717..2914782 + 66 NuclAT_22 - -
- 2914717..2914782 + 66 NuclAT_22 - -
- 2914717..2914782 + 66 NuclAT_23 - -
- 2914717..2914782 + 66 NuclAT_23 - -
- 2914717..2914782 + 66 NuclAT_23 - -
- 2914717..2914782 + 66 NuclAT_23 - -
- 2914717..2914782 + 66 NuclAT_24 - -
- 2914717..2914782 + 66 NuclAT_24 - -
- 2914717..2914782 + 66 NuclAT_24 - -
- 2914717..2914782 + 66 NuclAT_24 - -
- 2914717..2914782 + 66 NuclAT_25 - -
- 2914717..2914782 + 66 NuclAT_25 - -
- 2914717..2914782 + 66 NuclAT_25 - -
- 2914717..2914782 + 66 NuclAT_25 - -
H0272_RS14240 2915072..2916172 - 1101 WP_181464336.1 sodium-potassium/proton antiporter ChaA -
H0272_RS14245 2916442..2916681 + 240 WP_000120702.1 putative cation transport regulator ChaB -
H0272_RS14250 2916830..2917525 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
H0272_RS14255 2917569..2917922 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
H0272_RS14260 2918107..2919501 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T168473 WP_001531632.1 NZ_CP059281:c2914667-2914560 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T168473 NZ_CP076025:866529-866780 [Staphylococcus sp. MZ1]
ATGAATAACCGCGAACAAATTGAACAATCAATTATCAGTGCTAGTGCCTATAACGGTAATGACACAGAGGGATTACTAAA
AGAGGTTGAAGACGTGTATAAGAAAGCGCAAGCGTTTGATGAAATACTTGATGGAATGACAAATGCTATTCAACATTCAG
TTAAAGAAGGTGTTGAACTTGATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAACAGGAA
AATGAGTATTAG

Antitoxin


Download         Length: 67 bp

>AT168473 NZ_CP059281:2914715-2914781 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References