Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-timR/Ldr(toxin) |
| Location | 2914560..2914781 | Replicon | chromosome |
| Accession | NZ_CP059281 | ||
| Organism | Escherichia coli strain C9 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A1U9U3P9 |
| Locus tag | H0272_RS14235 | Protein ID | WP_001531632.1 |
| Coordinates | 2914560..2914667 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 2914715..2914781 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H0272_RS14210 | 2910404..2911486 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| H0272_RS14215 | 2911486..2912319 | + | 834 | WP_000456450.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| H0272_RS14220 | 2912316..2912708 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
| H0272_RS14225 | 2912712..2913521 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| H0272_RS14230 | 2913557..2914411 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| H0272_RS14235 | 2914560..2914667 | - | 108 | WP_001531632.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2914715..2914781 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_11 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_11 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_11 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_11 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 2914715..2914781 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 2914717..2914780 | + | 64 | NuclAT_14 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_14 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_14 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_14 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_15 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_15 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_15 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_15 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_16 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_16 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_16 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_16 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_17 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_17 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_17 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_17 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_18 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_18 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_18 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_18 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_19 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_19 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_19 | - | - |
| - | 2914717..2914780 | + | 64 | NuclAT_19 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_20 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_20 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_20 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_20 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_21 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_21 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_21 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_21 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_22 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_22 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_22 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_22 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_23 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_23 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_23 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_23 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_24 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_24 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_24 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_24 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_25 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_25 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_25 | - | - |
| - | 2914717..2914782 | + | 66 | NuclAT_25 | - | - |
| H0272_RS14240 | 2915072..2916172 | - | 1101 | WP_181464336.1 | sodium-potassium/proton antiporter ChaA | - |
| H0272_RS14245 | 2916442..2916681 | + | 240 | WP_000120702.1 | putative cation transport regulator ChaB | - |
| H0272_RS14250 | 2916830..2917525 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| H0272_RS14255 | 2917569..2917922 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
| H0272_RS14260 | 2918107..2919501 | + | 1395 | WP_000086187.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4040.89 Da Isoelectric Point: 12.5163
>T168473 WP_001531632.1 NZ_CP059281:c2914667-2914560 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T168473 NZ_CP076025:866529-866780 [Staphylococcus sp. MZ1]
ATGAATAACCGCGAACAAATTGAACAATCAATTATCAGTGCTAGTGCCTATAACGGTAATGACACAGAGGGATTACTAAA
AGAGGTTGAAGACGTGTATAAGAAAGCGCAAGCGTTTGATGAAATACTTGATGGAATGACAAATGCTATTCAACATTCAG
TTAAAGAAGGTGTTGAACTTGATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAACAGGAA
AATGAGTATTAG
ATGAATAACCGCGAACAAATTGAACAATCAATTATCAGTGCTAGTGCCTATAACGGTAATGACACAGAGGGATTACTAAA
AGAGGTTGAAGACGTGTATAAGAAAGCGCAAGCGTTTGATGAAATACTTGATGGAATGACAAATGCTATTCAACATTCAG
TTAAAGAAGGTGTTGAACTTGATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAACAGGAA
AATGAGTATTAG
Antitoxin
Download Length: 67 bp
>AT168473 NZ_CP059281:2914715-2914781 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|