Detailed information of TA system TA168435

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-timR/Ldr(toxin)
• Location: 2368912..2369133
• Replicon: chromosome
• Accession: NZ_CP059279
• Organism: Escherichia coli strain C7

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: H0271_RS11580
• Protein ID: WP_001531632.1
• Coordinates: 2368912..2369019 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	timR
Locus tag	-
Coordinates	2369067..2369133 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H0271_RS11555	2364756..2365838	+	1083	WP_000804726.1	peptide chain release factor 1	-
H0271_RS11560	2365838..2366671	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
H0271_RS11565	2366668..2367060	+	393	WP_000200375.1	invasion regulator SirB2	-
H0271_RS11570	2367064..2367873	+	810	WP_001257044.1	invasion regulator SirB1	-
H0271_RS11575	2367909..2368763	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
H0271_RS11580	2368912..2369019	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2369067..2369133	+	67	NuclAT_10	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_10	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_10	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_10	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_11	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_11	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_11	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_11	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_12	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_12	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_12	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_12	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_7	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_7	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_7	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_7	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_8	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_8	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_8	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_8	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_9	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_9	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_9	-	Antitoxin
-	2369067..2369133	+	67	NuclAT_9	-	Antitoxin
-	2369069..2369132	+	64	NuclAT_14	-	-
-	2369069..2369132	+	64	NuclAT_14	-	-
-	2369069..2369132	+	64	NuclAT_14	-	-
-	2369069..2369132	+	64	NuclAT_14	-	-
-	2369069..2369132	+	64	NuclAT_15	-	-
-	2369069..2369132	+	64	NuclAT_15	-	-
-	2369069..2369132	+	64	NuclAT_15	-	-
-	2369069..2369132	+	64	NuclAT_15	-	-
-	2369069..2369132	+	64	NuclAT_16	-	-
-	2369069..2369132	+	64	NuclAT_16	-	-
-	2369069..2369132	+	64	NuclAT_16	-	-
-	2369069..2369132	+	64	NuclAT_16	-	-
-	2369069..2369132	+	64	NuclAT_17	-	-
-	2369069..2369132	+	64	NuclAT_17	-	-
-	2369069..2369132	+	64	NuclAT_17	-	-
-	2369069..2369132	+	64	NuclAT_17	-	-
-	2369069..2369132	+	64	NuclAT_18	-	-
-	2369069..2369132	+	64	NuclAT_18	-	-
-	2369069..2369132	+	64	NuclAT_18	-	-
-	2369069..2369132	+	64	NuclAT_18	-	-
-	2369069..2369132	+	64	NuclAT_19	-	-
-	2369069..2369132	+	64	NuclAT_19	-	-
-	2369069..2369132	+	64	NuclAT_19	-	-
-	2369069..2369132	+	64	NuclAT_19	-	-
-	2369069..2369134	+	66	NuclAT_20	-	-
-	2369069..2369134	+	66	NuclAT_20	-	-
-	2369069..2369134	+	66	NuclAT_20	-	-
-	2369069..2369134	+	66	NuclAT_20	-	-
-	2369069..2369134	+	66	NuclAT_21	-	-
-	2369069..2369134	+	66	NuclAT_21	-	-
-	2369069..2369134	+	66	NuclAT_21	-	-
-	2369069..2369134	+	66	NuclAT_21	-	-
-	2369069..2369134	+	66	NuclAT_22	-	-
-	2369069..2369134	+	66	NuclAT_22	-	-
-	2369069..2369134	+	66	NuclAT_22	-	-
-	2369069..2369134	+	66	NuclAT_22	-	-
-	2369069..2369134	+	66	NuclAT_23	-	-
-	2369069..2369134	+	66	NuclAT_23	-	-
-	2369069..2369134	+	66	NuclAT_23	-	-
-	2369069..2369134	+	66	NuclAT_23	-	-
-	2369069..2369134	+	66	NuclAT_24	-	-
-	2369069..2369134	+	66	NuclAT_24	-	-
-	2369069..2369134	+	66	NuclAT_24	-	-
-	2369069..2369134	+	66	NuclAT_24	-	-
-	2369069..2369134	+	66	NuclAT_25	-	-
-	2369069..2369134	+	66	NuclAT_25	-	-
-	2369069..2369134	+	66	NuclAT_25	-	-
-	2369069..2369134	+	66	NuclAT_25	-	-
H0271_RS11585	2369424..2370524	-	1101	WP_181464336.1	sodium-potassium/proton antiporter ChaA	-
H0271_RS11590	2370794..2371033	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
H0271_RS11595	2371182..2371877	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
H0271_RS11600	2371921..2372274	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
H0271_RS11605	2372459..2373853	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T168435 WP_001531632.1 NZ_CP059279:c2369019-2368912 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T168435 NZ_CP075890:324617-324985 [Klebsiella pneumoniae]
ATGACGCTGCAGATTATCTCAGCGGAAGAGATAATACAGTTTCACGACAGGCTGCTCCGCGTCACGCCTGGCGTTGCCGG
TATGCCCGATCCAGGGCGTGCCGAAGCGATAATGTATAGGGTGCTAAACAAAATTGAATATGAAGGTGTGACAGACGTGT
GGCGACTCGCTGCGATGCATCTGCTGGCGATTTCTCGCGGTCATATATTTAATGATGGTAATAAGCGTACGGCACTGTTT
ATCACTCTGCTTTTTTTAAAGCGAAATGGAATTATATTGCCGGCGAATCCAGACTTCGTCGGCATGACCGTCGAGGCGGC
AGCAGGGCAACTTACCCTGGAACAGATTGTCGCGCGCTTGCGCGGATGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT168435 NZ_CP059279:2369067-2369133 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin