Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 2068404..2068711 | Replicon | chromosome |
Accession | NZ_CP059156 | ||
Organism | Staphylococcus aureus strain WKZ-1 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | HTZ90_RS10120 | Protein ID | WP_011447039.1 |
Coordinates | 2068535..2068711 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 2068404..2068543 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HTZ90_RS10080 | 2063742..2064002 | + | 261 | WP_001791826.1 | hypothetical protein | - |
HTZ90_RS10085 | 2064055..2064405 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
HTZ90_RS10090 | 2065091..2065540 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
HTZ90_RS10095 | 2065635..2065970 | - | 336 | Protein_1954 | SH3 domain-containing protein | - |
HTZ90_RS10100 | 2066620..2067111 | - | 492 | WP_000919350.1 | staphylokinase | - |
HTZ90_RS10105 | 2067302..2068057 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
HTZ90_RS10110 | 2068069..2068323 | - | 255 | WP_000611512.1 | phage holin | - |
HTZ90_RS10115 | 2068375..2068482 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2068404..2068543 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2068404..2068543 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2068404..2068543 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2068404..2068543 | + | 140 | NuclAT_0 | - | Antitoxin |
HTZ90_RS10120 | 2068535..2068711 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
HTZ90_RS10125 | 2068820..2069593 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
HTZ90_RS10130 | 2070014..2070388 | - | 375 | WP_000340977.1 | hypothetical protein | - |
HTZ90_RS10135 | 2070444..2070731 | - | 288 | WP_001040259.1 | hypothetical protein | - |
HTZ90_RS10140 | 2070778..2070930 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / sea / hlb / tsst-1 / groEL | 2064055..2134988 | 70933 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T168396 WP_011447039.1 NZ_CP059156:c2068711-2068535 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T168396 NZ_CP075852:1904959-1905111 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 140 bp
>AT168396 NZ_CP059156:2068404-2068543 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|