Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2571777..2571961 | Replicon | chromosome |
Accession | NZ_CP059155 | ||
Organism | Staphylococcus aureus strain WKZ-2 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | HTZ91_RS12835 | Protein ID | WP_000482647.1 |
Coordinates | 2571854..2571961 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2571777..2571837 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HTZ91_RS12820 | 2567287..2567454 | - | 168 | Protein_2485 | hypothetical protein | - |
HTZ91_RS12825 | 2567685..2569418 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
HTZ91_RS12830 | 2569443..2571206 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2571777..2571837 | + | 61 | - | - | Antitoxin |
HTZ91_RS12835 | 2571854..2571961 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
HTZ91_RS12840 | 2572095..2572481 | - | 387 | WP_000779351.1 | flippase GtxA | - |
HTZ91_RS12845 | 2572749..2573891 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
HTZ91_RS12850 | 2573951..2574610 | + | 660 | WP_000831298.1 | membrane protein | - |
HTZ91_RS12855 | 2574792..2576003 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
HTZ91_RS12860 | 2576126..2576599 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T168385 WP_000482647.1 NZ_CP059155:c2571961-2571854 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T168385 NZ_CP075740:48913-49065 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT168385 NZ_CP059155:2571777-2571837 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|