Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 2092653..2092960 | Replicon | chromosome |
| Accession | NZ_CP059155 | ||
| Organism | Staphylococcus aureus strain WKZ-2 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | HTZ91_RS10240 | Protein ID | WP_011447039.1 |
| Coordinates | 2092784..2092960 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 2092653..2092792 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTZ91_RS10200 | 2087991..2088251 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| HTZ91_RS10205 | 2088304..2088654 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| HTZ91_RS10210 | 2089340..2089789 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| HTZ91_RS10215 | 2089884..2090219 | - | 336 | Protein_1978 | SH3 domain-containing protein | - |
| HTZ91_RS10220 | 2090869..2091360 | - | 492 | WP_000919350.1 | staphylokinase | - |
| HTZ91_RS10225 | 2091551..2092306 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| HTZ91_RS10230 | 2092318..2092572 | - | 255 | WP_000611512.1 | phage holin | - |
| HTZ91_RS10235 | 2092624..2092731 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2092653..2092792 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 2092653..2092792 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 2092653..2092792 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 2092653..2092792 | + | 140 | NuclAT_0 | - | Antitoxin |
| HTZ91_RS10240 | 2092784..2092960 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| HTZ91_RS10245 | 2093069..2093842 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| HTZ91_RS10250 | 2094263..2094637 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| HTZ91_RS10255 | 2094693..2094980 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| HTZ91_RS10260 | 2095027..2095179 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / tsst-1 / groEL | 2036286..2156257 | 119971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T168376 WP_011447039.1 NZ_CP059155:c2092960-2092784 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T168376 NZ_CP075737:c2845409-2845302 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 140 bp
>AT168376 NZ_CP059155:2092653-2092792 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
