Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 133477..133806 | Replicon | plasmid pEc55_1 |
| Accession | NZ_CP059131 | ||
| Organism | Escherichia coli strain Ec55 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | H0X92_RS26255 | Protein ID | WP_001372321.1 |
| Coordinates | 133477..133602 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 133679..133806 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H0X92_RS26215 (128590) | 128590..128817 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| H0X92_RS26220 (128905) | 128905..129582 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| H0X92_RS26225 (129716) | 129716..130099 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| H0X92_RS26230 (130429) | 130429..131031 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| H0X92_RS26235 (131328) | 131328..132149 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| H0X92_RS26240 (132268) | 132268..132555 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| H0X92_RS26245 (132580) | 132580..132786 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| H0X92_RS26780 (132856) | 132856..133029 | + | 174 | Protein_157 | hypothetical protein | - |
| H0X92_RS26785 (133027) | 133027..133257 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| H0X92_RS26255 (133477) | 133477..133602 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H0X92_RS26790 (133544) | 133544..133693 | - | 150 | Protein_160 | plasmid maintenance protein Mok | - |
| - (133679) | 133679..133806 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (133679) | 133679..133806 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (133679) | 133679..133806 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (133679) | 133679..133806 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (135248) | 135248..135350 | - | 103 | NuclAT_1 | - | - |
| - (135248) | 135248..135350 | - | 103 | NuclAT_1 | - | - |
| - (135248) | 135248..135350 | - | 103 | NuclAT_1 | - | - |
| - (135248) | 135248..135350 | - | 103 | NuclAT_1 | - | - |
| H0X92_RS26265 (135319) | 135319..136081 | - | 763 | Protein_162 | plasmid SOS inhibition protein A | - |
| H0X92_RS26270 (136078) | 136078..136512 | - | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| H0X92_RS26275 (136567) | 136567..138525 | - | 1959 | WP_042045562.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 | senB | 1..167739 | 167739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T168362 WP_001372321.1 NZ_CP059131:c133602-133477 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T168362 NZ_CP075737:c371084-370977 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 128 bp
>AT168362 NZ_CP059131:c133806-133679 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|