Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2142881..2143102 Replicon chromosome
Accession NZ_CP059130
Organism Escherichia coli strain Ec55

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag H0X92_RS10480 Protein ID WP_001531632.1
Coordinates 2142881..2142988 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2143036..2143102 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H0X92_RS10455 (2138725) 2138725..2139807 + 1083 WP_000804726.1 peptide chain release factor 1 -
H0X92_RS10460 (2139807) 2139807..2140640 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
H0X92_RS10465 (2140637) 2140637..2141029 + 393 WP_000200375.1 invasion regulator SirB2 -
H0X92_RS10470 (2141033) 2141033..2141842 + 810 WP_001257044.1 invasion regulator SirB1 -
H0X92_RS10475 (2141878) 2141878..2142732 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H0X92_RS10480 (2142881) 2142881..2142988 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2143038) 2143038..2143101 + 64 NuclAT_12 - -
- (2143038) 2143038..2143101 + 64 NuclAT_12 - -
- (2143038) 2143038..2143101 + 64 NuclAT_12 - -
- (2143038) 2143038..2143101 + 64 NuclAT_12 - -
- (2143038) 2143038..2143101 + 64 NuclAT_13 - -
- (2143038) 2143038..2143101 + 64 NuclAT_13 - -
- (2143038) 2143038..2143101 + 64 NuclAT_13 - -
- (2143038) 2143038..2143101 + 64 NuclAT_13 - -
- (2143038) 2143038..2143101 + 64 NuclAT_14 - -
- (2143038) 2143038..2143101 + 64 NuclAT_14 - -
- (2143038) 2143038..2143101 + 64 NuclAT_14 - -
- (2143038) 2143038..2143101 + 64 NuclAT_14 - -
- (2143038) 2143038..2143101 + 64 NuclAT_15 - -
- (2143038) 2143038..2143101 + 64 NuclAT_15 - -
- (2143038) 2143038..2143101 + 64 NuclAT_15 - -
- (2143038) 2143038..2143101 + 64 NuclAT_15 - -
- (2143038) 2143038..2143101 + 64 NuclAT_16 - -
- (2143038) 2143038..2143101 + 64 NuclAT_16 - -
- (2143038) 2143038..2143101 + 64 NuclAT_16 - -
- (2143038) 2143038..2143101 + 64 NuclAT_16 - -
- (2143038) 2143038..2143101 + 64 NuclAT_17 - -
- (2143038) 2143038..2143101 + 64 NuclAT_17 - -
- (2143038) 2143038..2143101 + 64 NuclAT_17 - -
- (2143038) 2143038..2143101 + 64 NuclAT_17 - -
- (2143036) 2143036..2143102 + 67 NuclAT_10 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_10 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_10 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_10 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_5 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_5 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_5 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_5 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_6 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_6 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_6 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_6 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_7 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_7 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_7 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_7 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_8 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_8 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_8 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_8 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_9 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_9 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_9 - Antitoxin
- (2143036) 2143036..2143102 + 67 NuclAT_9 - Antitoxin
- (2143038) 2143038..2143103 + 66 NuclAT_18 - -
- (2143038) 2143038..2143103 + 66 NuclAT_18 - -
- (2143038) 2143038..2143103 + 66 NuclAT_18 - -
- (2143038) 2143038..2143103 + 66 NuclAT_18 - -
- (2143038) 2143038..2143103 + 66 NuclAT_19 - -
- (2143038) 2143038..2143103 + 66 NuclAT_19 - -
- (2143038) 2143038..2143103 + 66 NuclAT_19 - -
- (2143038) 2143038..2143103 + 66 NuclAT_19 - -
- (2143038) 2143038..2143103 + 66 NuclAT_20 - -
- (2143038) 2143038..2143103 + 66 NuclAT_20 - -
- (2143038) 2143038..2143103 + 66 NuclAT_20 - -
- (2143038) 2143038..2143103 + 66 NuclAT_20 - -
- (2143038) 2143038..2143103 + 66 NuclAT_21 - -
- (2143038) 2143038..2143103 + 66 NuclAT_21 - -
- (2143038) 2143038..2143103 + 66 NuclAT_21 - -
- (2143038) 2143038..2143103 + 66 NuclAT_21 - -
- (2143038) 2143038..2143103 + 66 NuclAT_22 - -
- (2143038) 2143038..2143103 + 66 NuclAT_22 - -
- (2143038) 2143038..2143103 + 66 NuclAT_22 - -
- (2143038) 2143038..2143103 + 66 NuclAT_22 - -
- (2143038) 2143038..2143103 + 66 NuclAT_23 - -
- (2143038) 2143038..2143103 + 66 NuclAT_23 - -
- (2143038) 2143038..2143103 + 66 NuclAT_23 - -
- (2143038) 2143038..2143103 + 66 NuclAT_23 - -
H0X92_RS10485 (2143393) 2143393..2144493 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
H0X92_RS10490 (2144763) 2144763..2145002 + 240 WP_000120702.1 putative cation transport regulator ChaB -
H0X92_RS10495 (2145151) 2145151..2145846 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
H0X92_RS10500 (2145890) 2145890..2146243 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
H0X92_RS10505 (2146428) 2146428..2147822 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T168339 WP_001531632.1 NZ_CP059130:c2142988-2142881 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T168339 NZ_CP075731:740609-740905 [Escherichia coli]
ATGGAAAAACGCACACCACATACACGTTTGAGTCAGGTTAAAAAACTTGTCAATGCCGGGCAAGTTCGTACAACACGTAG
TGCACTGTTAAATGCAGATGAGTTAGGTTTGGATTTTGATGGTATGTGTAATGTTATCATTGGATTATCAGAGAGCGACT
TTTATAAAAGCATGACCACCTACTCTGATCATACTATCTGGCAGGATGTTTACAGACCCAGGCTTGTTACAGGCCAGGTT
TATCTTAAAATTACGGTAATTCATGACGTACTGATCGTCTCGTTTAAGGAGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT168339 NZ_CP059130:2143036-2143102 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References