Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 101239..101472 | Replicon | plasmid pEc45_1 |
| Accession | NZ_CP059126 | ||
| Organism | Escherichia coli strain EC45 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | H0X93_RS24505 | Protein ID | WP_001372321.1 |
| Coordinates | 101239..101364 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 101441..101472 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H0X93_RS24480 (96613) | 96613..97302 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| H0X93_RS24485 (97489) | 97489..97872 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| H0X93_RS24490 (98193) | 98193..98795 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| H0X93_RS24495 (99092) | 99092..99913 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| H0X93_RS24500 (100031) | 100031..100318 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| H0X93_RS25195 (100343) | 100343..100549 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| H0X93_RS25200 (100619) | 100619..100791 | + | 173 | Protein_119 | hypothetical protein | - |
| H0X93_RS25205 (100789) | 100789..101019 | - | 231 | WP_071886920.1 | hypothetical protein | - |
| H0X93_RS24505 (101239) | 101239..101364 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H0X93_RS25210 (101306) | 101306..101455 | - | 150 | Protein_122 | plasmid maintenance protein Mok | - |
| - (101441) | 101441..101472 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (101441) | 101441..101472 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (101441) | 101441..101472 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (101441) | 101441..101472 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (102914) | 102914..103111 | - | 198 | NuclAT_0 | - | - |
| - (102914) | 102914..103111 | - | 198 | NuclAT_0 | - | - |
| - (102914) | 102914..103111 | - | 198 | NuclAT_0 | - | - |
| - (102914) | 102914..103111 | - | 198 | NuclAT_0 | - | - |
| H0X93_RS24515 (102923) | 102923..103111 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| H0X93_RS24520 (103080) | 103080..103842 | - | 763 | Protein_125 | plasmid SOS inhibition protein A | - |
| H0X93_RS24525 (103839) | 103839..104273 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| H0X93_RS24530 (104328) | 104328..104525 | - | 198 | Protein_127 | hypothetical protein | - |
| H0X93_RS24535 (104553) | 104553..104786 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| H0X93_RS24540 (104854) | 104854..105351 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aac(3)-IIa / tet(B) / catA1 / mph(A) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..146488 | 146488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T168324 WP_001372321.1 NZ_CP059126:c101364-101239 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T168324 NZ_CP075722:1802004-1802258 [Escherichia coli]
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
Antitoxin
Download Length: 32 bp
>AT168324 NZ_CP059126:c101472-101441 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|