Detailed information of TA system TA168288

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 129181..129414
• Replicon: plasmid pEc42_1
• Accession: NZ_CP059120
• Organism: Escherichia coli strain Ec42

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: H0X94_RS24530
• Protein ID: WP_001372321.1
• Coordinates: 129181..129306 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	129383..129414 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H0X94_RS24505 (124555)	124555..125244	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
H0X94_RS24510 (125431)	125431..125814	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
H0X94_RS24515 (126135)	126135..126737	+	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
H0X94_RS24520 (127034)	127034..127855	-	822	WP_001234426.1	DUF932 domain-containing protein	-
H0X94_RS24525 (127973)	127973..128260	-	288	WP_000107535.1	hypothetical protein	-
H0X94_RS25880 (128285)	128285..128491	-	207	WP_000547968.1	hypothetical protein	-
H0X94_RS25885 (128561)	128561..128733	+	173	Protein_158	hypothetical protein	-
H0X94_RS25890 (128731)	128731..128961	-	231	WP_071886920.1	hypothetical protein	-
H0X94_RS24530 (129181)	129181..129306	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
H0X94_RS25895 (129248)	129248..129397	-	150	Protein_161	plasmid maintenance protein Mok	-
- (129383)	129383..129414	-	32	NuclAT_1	-	Antitoxin
- (129383)	129383..129414	-	32	NuclAT_1	-	Antitoxin
- (129383)	129383..129414	-	32	NuclAT_1	-	Antitoxin
- (129383)	129383..129414	-	32	NuclAT_1	-	Antitoxin
- (130856)	130856..131053	-	198	NuclAT_0	-	-
- (130856)	130856..131053	-	198	NuclAT_0	-	-
- (130856)	130856..131053	-	198	NuclAT_0	-	-
- (130856)	130856..131053	-	198	NuclAT_0	-	-
H0X94_RS24540 (130865)	130865..131053	+	189	WP_001299721.1	hypothetical protein	-
H0X94_RS24545 (131022)	131022..131784	-	763	Protein_164	plasmid SOS inhibition protein A	-
H0X94_RS24550 (131781)	131781..132215	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
H0X94_RS24555 (132270)	132270..132467	-	198	Protein_166	hypothetical protein	-
H0X94_RS24560 (132495)	132495..132728	-	234	WP_000005990.1	DUF905 family protein	-
H0X94_RS24565 (132796)	132796..133335	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
H0X94_RS24570 (133361)	133361..133567	-	207	WP_000275856.1	hypothetical protein	-
H0X94_RS25900 (133807)	133807..134058	-	252	WP_071579736.1	hypothetical protein	-
H0X94_RS24575 (133977)	133977..134183	-	207	WP_001774176.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / tet(B) / qacE / aadA5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / sitABCD	iutA / iucD / iucC / iucB / iucA	1..171769	171769

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T168288 WP_001372321.1 NZ_CP059120:c129306-129181 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T168288 NZ_CP075699:77246-77527 [Escherichia coli]
ATGACTTATGAACTGGAATTTGAGCGCAGGGCCCTGAAAGAATGGCATAAGCTCGGTCATACAGTCCGTGAGCAGTTCAA
AAAGAAACTGTCAGAACGCCTGAAAAATCCAAGGGTCCCTGCTGCCAGGCTACATGGTCATACTGACCGTTATAAAATCA
AGCTTCGTGCATCTGGTTACAGGCTCGTCTATCAGGTGATTGATGAGAAAATTGTTTTGCTCGTTATTGCTGTAGGAAAA
AGGGAAAGCAGTGAGGTCTACCAGATGGCTGATATTCGCTGA

Antitoxin

Nucleotide

• Length: 32 bp

>AT168288 NZ_CP059120:c129414-129383 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin