Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 85751..86005 Replicon plasmid pEc42_1
Accession NZ_CP059120
Organism Escherichia coli strain Ec42

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag H0X94_RS24280 Protein ID WP_001312851.1
Coordinates 85751..85900 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 85944..86005 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H0X94_RS24250 (80998) 80998..81909 - 912 WP_000440183.1 carbamate kinase -
H0X94_RS24255 (81920) 81920..83140 - 1221 WP_000410951.1 arginine deiminase -
H0X94_RS24260 (83847) 83847..84461 + 615 Protein_103 VENN motif pre-toxin domain-containing protein -
H0X94_RS24265 (84461) 84461..84907 - 447 Protein_104 plasmid replication initiator RepA -
H0X94_RS24270 (84900) 84900..84974 - 75 WP_032336874.1 RepA leader peptide Tap -
H0X94_RS24275 (85210) 85210..85467 - 258 WP_000083833.1 replication regulatory protein RepA -
H0X94_RS24280 (85751) 85751..85900 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (85944) 85944..86005 + 62 NuclAT_2 - Antitoxin
- (85944) 85944..86005 + 62 NuclAT_2 - Antitoxin
- (85944) 85944..86005 + 62 NuclAT_2 - Antitoxin
- (85944) 85944..86005 + 62 NuclAT_2 - Antitoxin
H0X94_RS24285 (86144) 86144..86326 - 183 WP_000968309.1 hypothetical protein -
H0X94_RS24290 (86427) 86427..87043 + 617 Protein_109 IS1-like element IS1A family transposase -
H0X94_RS24295 (87081) 87081..88652 - 1572 WP_023149734.1 IS66-like element ISCro1 family transposase -
H0X94_RS24300 (88672) 88672..89019 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
H0X94_RS24305 (89019) 89019..89696 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
H0X94_RS24310 (89751) 89751..89840 + 90 Protein_113 IS1 family transposase -
H0X94_RS24315 (90141) 90141..90353 - 213 WP_005012601.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / tet(B) / qacE / aadA5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / sitABCD iutA / iucD / iucC / iucB / iucA 1..171769 171769


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T168284 WP_001312851.1 NZ_CP059120:c85900-85751 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T168284 NZ_CP075697:4869769-4869872 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT

Antitoxin


Download         Length: 62 bp

>AT168284 NZ_CP059120:85944-86005 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References