Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72217..72471 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP058880 | ||
| Organism | Escherichia coli strain STLEFF_29 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | HZT24_RS23925 | Protein ID | WP_001312851.1 |
| Coordinates | 72217..72366 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 72410..72471 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT24_RS23895 (67464) | 67464..68375 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| HZT24_RS23900 (68386) | 68386..69606 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| HZT24_RS23905 (70313) | 70313..70927 | + | 615 | Protein_82 | VENN motif pre-toxin domain-containing protein | - |
| HZT24_RS23910 (70927) | 70927..71373 | - | 447 | Protein_83 | plasmid replication initiator RepA | - |
| HZT24_RS23915 (71366) | 71366..71440 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| HZT24_RS23920 (71676) | 71676..71933 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| HZT24_RS23925 (72217) | 72217..72366 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (72410) | 72410..72471 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (72410) | 72410..72471 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (72410) | 72410..72471 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (72410) | 72410..72471 | + | 62 | NuclAT_0 | - | Antitoxin |
| HZT24_RS23930 (72610) | 72610..72792 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| HZT24_RS23935 (72893) | 72893..73509 | + | 617 | Protein_88 | IS1-like element IS1A family transposase | - |
| HZT24_RS23940 (73547) | 73547..75118 | - | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
| HZT24_RS23945 (75138) | 75138..75485 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| HZT24_RS23950 (75485) | 75485..76162 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| HZT24_RS23955 (76217) | 76217..76306 | + | 90 | Protein_92 | IS1 family transposase | - |
| HZT24_RS23960 (76607) | 76607..76819 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / lnu(F) / blaTEM-1B / sul3 / aph(3')-Ia / aac(3)-IId / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..121453 | 121453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T167914 WP_001312851.1 NZ_CP058880:c72366-72217 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T167914 NZ_CP075480:3609341-3609619 [Escherichia coli]
ATGATTCAAAGGGATATTGAATACTCGGGACAATTTTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAA
TAAATTGAAATATCTTATGACGCTTCTTATCAATAATGCTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAG
GTTCATGGAAAGGTTATCGCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGA
TTTGAGAGAACTGGAACTCACGCGGCGCTCTTTGGGTAA
ATGATTCAAAGGGATATTGAATACTCGGGACAATTTTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAA
TAAATTGAAATATCTTATGACGCTTCTTATCAATAATGCTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAG
GTTCATGGAAAGGTTATCGCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGA
TTTGAGAGAACTGGAACTCACGCGGCGCTCTTTGGGTAA
Antitoxin
Download Length: 62 bp
>AT167914 NZ_CP058880:72410-72471 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|