Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 66128..66381 | Replicon | plasmid unnamed3 |
Accession | NZ_CP058877 | ||
Organism | Escherichia coli strain STLEFF_47 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | HZT32_RS25970 | Protein ID | WP_001312851.1 |
Coordinates | 66232..66381 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 66128..66187 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZT32_RS25945 (62855) | 62855..63601 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
HZT32_RS25950 (63656) | 63656..64216 | + | 561 | WP_063097573.1 | fertility inhibition protein FinO | - |
HZT32_RS25955 (64348) | 64348..64548 | + | 201 | WP_015059022.1 | hypothetical protein | - |
HZT32_RS25960 (64934) | 64934..65533 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
HZT32_RS25965 (65595) | 65595..65927 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (66128) | 66128..66187 | - | 60 | NuclAT_1 | - | Antitoxin |
- (66128) | 66128..66187 | - | 60 | NuclAT_1 | - | Antitoxin |
- (66128) | 66128..66187 | - | 60 | NuclAT_1 | - | Antitoxin |
- (66128) | 66128..66187 | - | 60 | NuclAT_1 | - | Antitoxin |
HZT32_RS25970 (66232) | 66232..66381 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
HZT32_RS25975 (66665) | 66665..66913 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / blaTEM-1B / rmtB | - | 1..67224 | 67224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T167886 WP_001312851.1 NZ_CP058877:66232-66381 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T167886 NZ_CP075477:2692891-2692998 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT167886 NZ_CP058877:c66187-66128 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|