Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 274006..274228 | Replicon | chromosome |
| Accession | NZ_CP058874 | ||
| Organism | Escherichia coli strain STLEFF_47 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | HZT32_RS01325 | Protein ID | WP_001295224.1 |
| Coordinates | 274121..274228 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 274006..274072 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT32_RS01305 | 269447..270349 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| HZT32_RS01310 | 270360..271343 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| HZT32_RS01315 | 271340..272344 | + | 1005 | WP_240724426.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| HZT32_RS01320 | 272374..273645 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| - | 274006..274072 | - | 67 | - | - | Antitoxin |
| HZT32_RS01325 | 274121..274228 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| HZT32_RS01330 | 274604..274711 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| HZT32_RS01335 | 274798..276477 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| HZT32_RS01340 | 276474..276665 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| HZT32_RS01345 | 276662..278233 | - | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| HZT32_RS01350 | 278506..278694 | + | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T167843 WP_001295224.1 NZ_CP058874:274121-274228 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T167843 NZ_CP075472:2567119-2567226 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT167843 NZ_CP058874:c274072-274006 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|