Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59274..59543 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP058840 | ||
| Organism | Shigella flexneri strain STLEFF_34 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | HZT26_RS23690 | Protein ID | WP_001372321.1 |
| Coordinates | 59418..59543 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 59274..59339 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT26_RS23645 | 54382..54753 | + | 372 | WP_223372515.1 | hypothetical protein | - |
| HZT26_RS23650 | 54898..55104 | + | 207 | WP_015059635.1 | hypothetical protein | - |
| HZT26_RS23655 | 55130..55582 | + | 453 | WP_063072992.1 | single-stranded DNA-binding protein | - |
| HZT26_RS23660 | 55644..55877 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| HZT26_RS23665 | 55942..57900 | + | 1959 | WP_063072993.1 | ParB/RepB/Spo0J family partition protein | - |
| HZT26_RS23670 | 57955..58389 | + | 435 | WP_000845907.1 | conjugation system SOS inhibitor PsiB | - |
| HZT26_RS23675 | 58386..59105 | + | 720 | WP_001276240.1 | plasmid SOS inhibition protein A | - |
| HZT26_RS23680 | 59117..59305 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 59117..59341 | + | 225 | NuclAT_0 | - | - |
| - | 59117..59341 | + | 225 | NuclAT_0 | - | - |
| - | 59117..59341 | + | 225 | NuclAT_0 | - | - |
| - | 59117..59341 | + | 225 | NuclAT_0 | - | - |
| - | 59274..59339 | - | 66 | - | - | Antitoxin |
| HZT26_RS23685 | 59327..59476 | + | 150 | Protein_76 | plasmid maintenance protein Mok | - |
| HZT26_RS23690 | 59418..59543 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HZT26_RS23695 | 59763..59993 | + | 231 | WP_071845785.1 | hypothetical protein | - |
| HZT26_RS23700 | 59991..60164 | - | 174 | Protein_79 | hypothetical protein | - |
| HZT26_RS23705 | 60234..60440 | + | 207 | WP_063609967.1 | hypothetical protein | - |
| HZT26_RS23710 | 60465..60752 | + | 288 | WP_063072995.1 | hypothetical protein | - |
| HZT26_RS23715 | 60871..61692 | + | 822 | WP_001241365.1 | DUF932 domain-containing protein | - |
| HZT26_RS23720 | 61989..62579 | - | 591 | WP_222908884.1 | transglycosylase SLT domain-containing protein | - |
| HZT26_RS23725 | 62982..63365 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HZT26_RS23730 | 63552..64241 | + | 690 | WP_000283379.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cmlA1 / qacE / blaCTX-M-14 / erm(B) / mph(A) | - | 1..98962 | 98962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T167675 WP_001372321.1 NZ_CP058840:59418-59543 [Shigella flexneri]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T167675 NZ_CP075325:c2020714-2020424 [Xanthomonas citri pv. citri]
ATGACGACGATCACCGCAACCGAAGAATTCACCACCTGGCTGCGCAAGCTGCGTGACACCAAGGCCAAGGCCGTGATCAT
TGAACGTGTGCAGCGCGTCGCCCGTGGCCTGCTCGGCGATGTTGAGCCGGTGGGCGGCCCGGTTAGCGAGCTGCGCATCC
ACTACGGACCCGGCTACCGGGTCTACTTCACCCGGCGCGGTGAGGAGGTCGTCATCCTCCTCTGCGGCGGTGACAAGACC
ACCCAGACCAAGGACATCAAGAAAGCGCAAGCCCTCGCCGCCGGCCTCTGA
ATGACGACGATCACCGCAACCGAAGAATTCACCACCTGGCTGCGCAAGCTGCGTGACACCAAGGCCAAGGCCGTGATCAT
TGAACGTGTGCAGCGCGTCGCCCGTGGCCTGCTCGGCGATGTTGAGCCGGTGGGCGGCCCGGTTAGCGAGCTGCGCATCC
ACTACGGACCCGGCTACCGGGTCTACTTCACCCGGCGCGGTGAGGAGGTCGTCATCCTCCTCTGCGGCGGTGACAAGACC
ACCCAGACCAAGGACATCAAGAAAGCGCAAGCCCTCGCCGCCGGCCTCTGA
Antitoxin
Download Length: 66 bp
>AT167675 NZ_CP058840:c59339-59274 [Shigella flexneri]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|