Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 63885..64306 | Replicon | plasmid unnamed1 |
Accession | NZ_CP058791 | ||
Organism | Shigella flexneri strain STLIN_6 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | HZT08_RS23750 | Protein ID | WP_096937776.1 |
Coordinates | 63885..64010 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 64108..64306 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZT08_RS23720 (60026) | 60026..60664 | - | 639 | WP_000777698.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
HZT08_RS23725 (60673) | 60673..61665 | - | 993 | WP_000830183.1 | conjugal transfer pilus assembly protein TraU | - |
HZT08_RS23730 (61662) | 61662..62294 | - | 633 | WP_001203720.1 | type-F conjugative transfer system protein TraW | - |
HZT08_RS23735 (62291) | 62291..62677 | - | 387 | WP_000099690.1 | type-F conjugative transfer system protein TrbI | - |
HZT08_RS23740 (62674) | 62674..62991 | - | 318 | Protein_73 | hypothetical protein | - |
HZT08_RS23745 (63307) | 63307..63584 | + | 278 | Protein_74 | hypothetical protein | - |
HZT08_RS23750 (63885) | 63885..64010 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HZT08_RS23755 (63952) | 63952..64101 | - | 150 | Protein_76 | DUF5431 family protein | - |
- (64108) | 64108..64306 | - | 199 | NuclAT_0 | - | Antitoxin |
- (64108) | 64108..64306 | - | 199 | NuclAT_0 | - | Antitoxin |
- (64108) | 64108..64306 | - | 199 | NuclAT_0 | - | Antitoxin |
- (64108) | 64108..64306 | - | 199 | NuclAT_0 | - | Antitoxin |
HZT08_RS23760 (64275) | 64275..65037 | - | 763 | Protein_77 | plasmid SOS inhibition protein A | - |
HZT08_RS23765 (65034) | 65034..65468 | - | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
HZT08_RS23770 (65523) | 65523..67481 | - | 1959 | WP_000117171.1 | ParB/RepB/Spo0J family partition protein | - |
HZT08_RS23775 (67547) | 67547..67780 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
HZT08_RS23780 (67837) | 67837..68370 | - | 534 | WP_240766720.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | estIa / paa / hlyD / hlyB / hlyA / hlyC | 1..137079 | 137079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T167523 WP_096937776.1 NZ_CP058791:c64010-63885 [Shigella flexneri]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
>T167523 NZ_CP075140:2078230-2078333 [Salmonella enterica]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 199 bp
>AT167523 NZ_CP058791:c64306-64108 [Shigella flexneri]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|