Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2688449..2688669 Replicon chromosome
Accession NZ_CP058790
Organism Shigella flexneri strain STLIN_6

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag HZT08_RS13065 Protein ID WP_000170965.1
Coordinates 2688562..2688669 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2688449..2688515 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HZT08_RS13040 2683729..2685123 - 1395 WP_000086213.1 inverse autotransporter invasin YchO -
HZT08_RS13045 2685308..2685661 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HZT08_RS13050 2685705..2686400 - 696 WP_001351485.1 glutathione-specific gamma-glutamylcyclotransferase -
HZT08_RS13055 2686558..2686788 - 231 WP_001146442.1 putative cation transport regulator ChaB -
HZT08_RS13060 2687057..2688157 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2688449..2688515 - 67 - - Antitoxin
HZT08_RS13065 2688562..2688669 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2688982..2689045 - 64 NuclAT_34 - -
- 2688982..2689045 - 64 NuclAT_34 - -
- 2688982..2689045 - 64 NuclAT_34 - -
- 2688982..2689045 - 64 NuclAT_34 - -
- 2688982..2689045 - 64 NuclAT_36 - -
- 2688982..2689045 - 64 NuclAT_36 - -
- 2688982..2689045 - 64 NuclAT_36 - -
- 2688982..2689045 - 64 NuclAT_36 - -
- 2688982..2689045 - 64 NuclAT_38 - -
- 2688982..2689045 - 64 NuclAT_38 - -
- 2688982..2689045 - 64 NuclAT_38 - -
- 2688982..2689045 - 64 NuclAT_38 - -
- 2688982..2689045 - 64 NuclAT_40 - -
- 2688982..2689045 - 64 NuclAT_40 - -
- 2688982..2689045 - 64 NuclAT_40 - -
- 2688982..2689045 - 64 NuclAT_40 - -
- 2688982..2689045 - 64 NuclAT_42 - -
- 2688982..2689045 - 64 NuclAT_42 - -
- 2688982..2689045 - 64 NuclAT_42 - -
- 2688982..2689045 - 64 NuclAT_42 - -
- 2688982..2689045 - 64 NuclAT_44 - -
- 2688982..2689045 - 64 NuclAT_44 - -
- 2688982..2689045 - 64 NuclAT_44 - -
- 2688982..2689045 - 64 NuclAT_44 - -
- 2688983..2689045 - 63 NuclAT_46 - -
- 2688983..2689045 - 63 NuclAT_46 - -
- 2688983..2689045 - 63 NuclAT_46 - -
- 2688983..2689045 - 63 NuclAT_46 - -
- 2688983..2689045 - 63 NuclAT_49 - -
- 2688983..2689045 - 63 NuclAT_49 - -
- 2688983..2689045 - 63 NuclAT_49 - -
- 2688983..2689045 - 63 NuclAT_49 - -
- 2688984..2689045 - 62 NuclAT_16 - -
- 2688984..2689045 - 62 NuclAT_16 - -
- 2688984..2689045 - 62 NuclAT_16 - -
- 2688984..2689045 - 62 NuclAT_16 - -
- 2688984..2689045 - 62 NuclAT_19 - -
- 2688984..2689045 - 62 NuclAT_19 - -
- 2688984..2689045 - 62 NuclAT_19 - -
- 2688984..2689045 - 62 NuclAT_19 - -
- 2688984..2689045 - 62 NuclAT_22 - -
- 2688984..2689045 - 62 NuclAT_22 - -
- 2688984..2689045 - 62 NuclAT_22 - -
- 2688984..2689045 - 62 NuclAT_22 - -
- 2688984..2689045 - 62 NuclAT_25 - -
- 2688984..2689045 - 62 NuclAT_25 - -
- 2688984..2689045 - 62 NuclAT_25 - -
- 2688984..2689045 - 62 NuclAT_25 - -
- 2688984..2689045 - 62 NuclAT_28 - -
- 2688984..2689045 - 62 NuclAT_28 - -
- 2688984..2689045 - 62 NuclAT_28 - -
- 2688984..2689045 - 62 NuclAT_28 - -
- 2688984..2689045 - 62 NuclAT_31 - -
- 2688984..2689045 - 62 NuclAT_31 - -
- 2688984..2689045 - 62 NuclAT_31 - -
- 2688984..2689045 - 62 NuclAT_31 - -
HZT08_RS13070 2689098..2689205 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2689519..2689585 - 67 NuclAT_45 - -
- 2689519..2689585 - 67 NuclAT_45 - -
- 2689519..2689585 - 67 NuclAT_45 - -
- 2689519..2689585 - 67 NuclAT_45 - -
- 2689519..2689585 - 67 NuclAT_48 - -
- 2689519..2689585 - 67 NuclAT_48 - -
- 2689519..2689585 - 67 NuclAT_48 - -
- 2689519..2689585 - 67 NuclAT_48 - -
- 2689520..2689583 - 64 NuclAT_17 - -
- 2689520..2689583 - 64 NuclAT_17 - -
- 2689520..2689583 - 64 NuclAT_17 - -
- 2689520..2689583 - 64 NuclAT_17 - -
- 2689520..2689583 - 64 NuclAT_20 - -
- 2689520..2689583 - 64 NuclAT_20 - -
- 2689520..2689583 - 64 NuclAT_20 - -
- 2689520..2689583 - 64 NuclAT_20 - -
- 2689520..2689583 - 64 NuclAT_23 - -
- 2689520..2689583 - 64 NuclAT_23 - -
- 2689520..2689583 - 64 NuclAT_23 - -
- 2689520..2689583 - 64 NuclAT_23 - -
- 2689520..2689583 - 64 NuclAT_26 - -
- 2689520..2689583 - 64 NuclAT_26 - -
- 2689520..2689583 - 64 NuclAT_26 - -
- 2689520..2689583 - 64 NuclAT_26 - -
- 2689520..2689583 - 64 NuclAT_29 - -
- 2689520..2689583 - 64 NuclAT_29 - -
- 2689520..2689583 - 64 NuclAT_29 - -
- 2689520..2689583 - 64 NuclAT_29 - -
- 2689520..2689583 - 64 NuclAT_32 - -
- 2689520..2689583 - 64 NuclAT_32 - -
- 2689520..2689583 - 64 NuclAT_32 - -
- 2689520..2689583 - 64 NuclAT_32 - -
HZT08_RS13075 2689633..2689740 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
HZT08_RS13080 2689889..2690743 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HZT08_RS13085 2690779..2691588 - 810 WP_001257044.1 invasion regulator SirB1 -
HZT08_RS13090 2691592..2691984 - 393 WP_000200374.1 invasion regulator SirB2 -
HZT08_RS13095 2691981..2692814 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T167510 WP_000170965.1 NZ_CP058790:2688562-2688669 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T167510 NZ_CP075138:2039053-2039156 [Salmonella enterica]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 67 bp

>AT167510 NZ_CP058790:c2688515-2688449 [Shigella flexneri]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References