Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2688449..2688669 | Replicon | chromosome |
| Accession | NZ_CP058790 | ||
| Organism | Shigella flexneri strain STLIN_6 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | HZT08_RS13065 | Protein ID | WP_000170965.1 |
| Coordinates | 2688562..2688669 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2688449..2688515 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT08_RS13040 | 2683729..2685123 | - | 1395 | WP_000086213.1 | inverse autotransporter invasin YchO | - |
| HZT08_RS13045 | 2685308..2685661 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| HZT08_RS13050 | 2685705..2686400 | - | 696 | WP_001351485.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| HZT08_RS13055 | 2686558..2686788 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| HZT08_RS13060 | 2687057..2688157 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2688449..2688515 | - | 67 | - | - | Antitoxin |
| HZT08_RS13065 | 2688562..2688669 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2688982..2689045 | - | 64 | NuclAT_34 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_34 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_34 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_34 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_36 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_36 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_36 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_36 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_38 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_38 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_38 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_38 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_40 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_40 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_40 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_40 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_42 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_42 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_42 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_42 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_44 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_44 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_44 | - | - |
| - | 2688982..2689045 | - | 64 | NuclAT_44 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_46 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_46 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_46 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_46 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_49 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_49 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_49 | - | - |
| - | 2688983..2689045 | - | 63 | NuclAT_49 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_16 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_16 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_16 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_16 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_19 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_19 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_19 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_19 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_22 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_22 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_22 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_22 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_25 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_25 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_25 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_25 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_28 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_28 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_28 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_28 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_31 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_31 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_31 | - | - |
| - | 2688984..2689045 | - | 62 | NuclAT_31 | - | - |
| HZT08_RS13070 | 2689098..2689205 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2689519..2689585 | - | 67 | NuclAT_45 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_45 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_45 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_45 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_48 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_48 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_48 | - | - |
| - | 2689519..2689585 | - | 67 | NuclAT_48 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_17 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_17 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_17 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_17 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_20 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_20 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_20 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_20 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_23 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_23 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_23 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_23 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_26 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_26 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_26 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_26 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_29 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_29 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_29 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_29 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_32 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_32 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_32 | - | - |
| - | 2689520..2689583 | - | 64 | NuclAT_32 | - | - |
| HZT08_RS13075 | 2689633..2689740 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| HZT08_RS13080 | 2689889..2690743 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| HZT08_RS13085 | 2690779..2691588 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| HZT08_RS13090 | 2691592..2691984 | - | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| HZT08_RS13095 | 2691981..2692814 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T167510 WP_000170965.1 NZ_CP058790:2688562-2688669 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T167510 NZ_CP075138:2039053-2039156 [Salmonella enterica]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 67 bp
>AT167510 NZ_CP058790:c2688515-2688449 [Shigella flexneri]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|