Detailed information of TA system TA167267

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 68301..68570
• Replicon: plasmid pM159-1.3
• Accession: NZ_CP058722
• Organism: Escherichia coli strain M159-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: HZS86_RS23510
• Protein ID: WP_001372321.1
• Coordinates: 68445..68570 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	68301..68366 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HZS86_RS23465 (63329)	63329..63595	+	267	WP_072667006.1	hypothetical protein	-
HZS86_RS23470 (63836)	63836..64042	+	207	WP_000275858.1	hypothetical protein	-
HZS86_RS23475 (64068)	64068..64607	+	540	WP_001825195.1	single-stranded DNA-binding protein	-
HZS86_RS23480 (64670)	64670..64903	+	234	WP_000005990.1	DUF905 family protein	-
HZS86_RS23485 (64969)	64969..66927	+	1959	WP_001825193.1	ParB/RepB/Spo0J family partition protein	-
HZS86_RS23490 (66982)	66982..67416	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
HZS86_RS23495 (67413)	67413..68175	+	763	Protein_76	plasmid SOS inhibition protein A	-
HZS86_RS23500 (68144)	68144..68332	-	189	WP_001299721.1	hypothetical protein	-
- (68301)	68301..68366	+	66	NuclAT_1	-	-
- (68301)	68301..68366	-	66	NuclAT_0	-	Antitoxin
- (68301)	68301..68366	-	66	NuclAT_0	-	Antitoxin
- (68144)	68144..68368	+	225	NuclAT_0	-	-
- (68144)	68144..68368	+	225	NuclAT_0	-	-
- (68144)	68144..68368	+	225	NuclAT_0	-	-
- (68144)	68144..68368	+	225	NuclAT_0	-	-
- (68144)	68144..68368	-	225	NuclAT_0	-	-
HZS86_RS23505 (68354)	68354..68503	+	150	Protein_78	plasmid maintenance protein Mok	-
HZS86_RS23510 (68445)	68445..68570	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
HZS86_RS23515 (68790)	68790..69020	+	231	WP_001426396.1	hypothetical protein	-
HZS86_RS23520 (69018)	69018..69191	-	174	Protein_81	hypothetical protein	-
HZS86_RS23525 (69261)	69261..69467	+	207	WP_000547968.1	hypothetical protein	-
HZS86_RS23530 (69492)	69492..69779	+	288	WP_000107544.1	hypothetical protein	-
HZS86_RS23535 (69900)	69900..70721	+	822	WP_001234469.1	DUF932 domain-containing protein	-
HZS86_RS23540 (71018)	71018..71665	-	648	WP_031943493.1	transglycosylase SLT domain-containing protein	-
HZS86_RS23545 (71942)	71942..72325	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
HZS86_RS23550 (72516)	72516..73202	+	687	WP_000332484.1	PAS domain-containing protein	-
HZS86_RS23555 (73296)	73296..73523	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T167267 WP_001372321.1 NZ_CP058722:68445-68570 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T167267 NZ_CP075108:3365387-3365605 [Salmonella enterica]
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAGCTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACAATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT167267 NZ_CP058722:c68366-68301 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin