Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68301..68570 | Replicon | plasmid pM159-1.3 |
| Accession | NZ_CP058722 | ||
| Organism | Escherichia coli strain M159-1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | HZS86_RS23510 | Protein ID | WP_001372321.1 |
| Coordinates | 68445..68570 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 68301..68366 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZS86_RS23465 (63329) | 63329..63595 | + | 267 | WP_072667006.1 | hypothetical protein | - |
| HZS86_RS23470 (63836) | 63836..64042 | + | 207 | WP_000275858.1 | hypothetical protein | - |
| HZS86_RS23475 (64068) | 64068..64607 | + | 540 | WP_001825195.1 | single-stranded DNA-binding protein | - |
| HZS86_RS23480 (64670) | 64670..64903 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| HZS86_RS23485 (64969) | 64969..66927 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
| HZS86_RS23490 (66982) | 66982..67416 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| HZS86_RS23495 (67413) | 67413..68175 | + | 763 | Protein_76 | plasmid SOS inhibition protein A | - |
| HZS86_RS23500 (68144) | 68144..68332 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (68301) | 68301..68366 | + | 66 | NuclAT_1 | - | - |
| - (68301) | 68301..68366 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (68301) | 68301..68366 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (68144) | 68144..68368 | + | 225 | NuclAT_0 | - | - |
| - (68144) | 68144..68368 | + | 225 | NuclAT_0 | - | - |
| - (68144) | 68144..68368 | + | 225 | NuclAT_0 | - | - |
| - (68144) | 68144..68368 | + | 225 | NuclAT_0 | - | - |
| - (68144) | 68144..68368 | - | 225 | NuclAT_0 | - | - |
| HZS86_RS23505 (68354) | 68354..68503 | + | 150 | Protein_78 | plasmid maintenance protein Mok | - |
| HZS86_RS23510 (68445) | 68445..68570 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HZS86_RS23515 (68790) | 68790..69020 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| HZS86_RS23520 (69018) | 69018..69191 | - | 174 | Protein_81 | hypothetical protein | - |
| HZS86_RS23525 (69261) | 69261..69467 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| HZS86_RS23530 (69492) | 69492..69779 | + | 288 | WP_000107544.1 | hypothetical protein | - |
| HZS86_RS23535 (69900) | 69900..70721 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| HZS86_RS23540 (71018) | 71018..71665 | - | 648 | WP_031943493.1 | transglycosylase SLT domain-containing protein | - |
| HZS86_RS23545 (71942) | 71942..72325 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HZS86_RS23550 (72516) | 72516..73202 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| HZS86_RS23555 (73296) | 73296..73523 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T167267 WP_001372321.1 NZ_CP058722:68445-68570 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T167267 NZ_CP075108:3365387-3365605 [Salmonella enterica]
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAGCTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACAATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAGCTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACAATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA
Antitoxin
Download Length: 66 bp
>AT167267 NZ_CP058722:c68366-68301 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|