Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 4097884..4098105 Replicon chromosome
Accession NZ_CP058714
Organism Escherichia coli strain M172-1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag HYI45_RS19530 Protein ID WP_000176713.1
Coordinates 4097884..4097991 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 4098039..4098105 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HYI45_RS19505 (4093728) 4093728..4094810 + 1083 WP_000804726.1 peptide chain release factor 1 -
HYI45_RS19510 (4094810) 4094810..4095643 + 834 WP_000456446.1 peptide chain release factor N(5)-glutamine methyltransferase -
HYI45_RS19515 (4095640) 4095640..4096032 + 393 WP_000200374.1 invasion regulator SirB2 -
HYI45_RS19520 (4096036) 4096036..4096845 + 810 WP_001257044.1 invasion regulator SirB1 -
HYI45_RS19525 (4096881) 4096881..4097735 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HYI45_RS19530 (4097884) 4097884..4097991 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4098041) 4098041..4098104 + 64 NuclAT_49 - -
- (4098041) 4098041..4098104 + 64 NuclAT_49 - -
- (4098041) 4098041..4098104 + 64 NuclAT_49 - -
- (4098041) 4098041..4098104 + 64 NuclAT_49 - -
- (4098041) 4098041..4098104 + 64 NuclAT_51 - -
- (4098041) 4098041..4098104 + 64 NuclAT_51 - -
- (4098041) 4098041..4098104 + 64 NuclAT_51 - -
- (4098041) 4098041..4098104 + 64 NuclAT_51 - -
- (4098041) 4098041..4098104 + 64 NuclAT_53 - -
- (4098041) 4098041..4098104 + 64 NuclAT_53 - -
- (4098041) 4098041..4098104 + 64 NuclAT_53 - -
- (4098041) 4098041..4098104 + 64 NuclAT_53 - -
- (4098039) 4098039..4098105 + 67 NuclAT_11 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_11 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_11 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_11 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_13 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_13 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_13 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_13 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_15 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_15 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_15 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_15 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_17 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_17 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_17 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_17 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_19 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_19 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_19 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_19 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_21 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_21 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_21 - Antitoxin
- (4098039) 4098039..4098105 + 67 NuclAT_21 - Antitoxin
HYI45_RS19535 (4098419) 4098419..4098526 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4098579) 4098579..4098640 + 62 NuclAT_48 - -
- (4098579) 4098579..4098640 + 62 NuclAT_48 - -
- (4098579) 4098579..4098640 + 62 NuclAT_48 - -
- (4098579) 4098579..4098640 + 62 NuclAT_48 - -
- (4098579) 4098579..4098640 + 62 NuclAT_50 - -
- (4098579) 4098579..4098640 + 62 NuclAT_50 - -
- (4098579) 4098579..4098640 + 62 NuclAT_50 - -
- (4098579) 4098579..4098640 + 62 NuclAT_50 - -
- (4098579) 4098579..4098640 + 62 NuclAT_52 - -
- (4098579) 4098579..4098640 + 62 NuclAT_52 - -
- (4098579) 4098579..4098640 + 62 NuclAT_52 - -
- (4098579) 4098579..4098640 + 62 NuclAT_52 - -
- (4098579) 4098579..4098641 + 63 NuclAT_12 - -
- (4098579) 4098579..4098641 + 63 NuclAT_12 - -
- (4098579) 4098579..4098641 + 63 NuclAT_12 - -
- (4098579) 4098579..4098641 + 63 NuclAT_12 - -
- (4098579) 4098579..4098641 + 63 NuclAT_14 - -
- (4098579) 4098579..4098641 + 63 NuclAT_14 - -
- (4098579) 4098579..4098641 + 63 NuclAT_14 - -
- (4098579) 4098579..4098641 + 63 NuclAT_14 - -
- (4098579) 4098579..4098641 + 63 NuclAT_16 - -
- (4098579) 4098579..4098641 + 63 NuclAT_16 - -
- (4098579) 4098579..4098641 + 63 NuclAT_16 - -
- (4098579) 4098579..4098641 + 63 NuclAT_16 - -
- (4098579) 4098579..4098641 + 63 NuclAT_18 - -
- (4098579) 4098579..4098641 + 63 NuclAT_18 - -
- (4098579) 4098579..4098641 + 63 NuclAT_18 - -
- (4098579) 4098579..4098641 + 63 NuclAT_18 - -
- (4098579) 4098579..4098641 + 63 NuclAT_20 - -
- (4098579) 4098579..4098641 + 63 NuclAT_20 - -
- (4098579) 4098579..4098641 + 63 NuclAT_20 - -
- (4098579) 4098579..4098641 + 63 NuclAT_20 - -
- (4098579) 4098579..4098641 + 63 NuclAT_22 - -
- (4098579) 4098579..4098641 + 63 NuclAT_22 - -
- (4098579) 4098579..4098641 + 63 NuclAT_22 - -
- (4098579) 4098579..4098641 + 63 NuclAT_22 - -
HYI45_RS19540 (4098932) 4098932..4100032 - 1101 WP_001317783.1 sodium-potassium/proton antiporter ChaA -
HYI45_RS19545 (4100302) 4100302..4100532 + 231 WP_001146444.1 putative cation transport regulator ChaB -
HYI45_RS19550 (4100690) 4100690..4101385 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
HYI45_RS19555 (4101429) 4101429..4101782 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T167219 WP_000176713.1 NZ_CP058714:c4097991-4097884 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T167219 NZ_CP075062:1904254-1904508 [Escherichia coli]
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA

Antitoxin


Download         Length: 67 bp

>AT167219 NZ_CP058714:4098039-4098105 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References