Detailed information of TA system TA167019

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 143629..143883
• Replicon: plasmid p1_035123
• Accession: NZ_CP058653
• Organism: Escherichia coli strain WCHEC035123

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: HZR24_RS23580
• Protein ID: WP_015387399.1
• Coordinates: 143677..143883 (+)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	143629..143690 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HZR24_RS23550	138966..139196	+	231	WP_001261286.1	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	-
HZR24_RS23555	139193..139609	+	417	WP_001034044.1	type II toxin-antitoxin system VapC family toxin	-
HZR24_RS23560	139684..141249	+	1566	WP_001128474.1	AAA family ATPase	-
HZR24_RS23565	141234..142256	+	1023	WP_000361402.1	helicase UvrD	-
HZR24_RS23570	142510..143207	-	698	Protein_155	IS1-like element IS1A family transposase	-
HZR24_RS23575	143308..143490	+	183	WP_000968309.1	hypothetical protein	-
-	143629..143690	-	62	NuclAT_0	-	Antitoxin
-	143629..143690	-	62	NuclAT_0	-	Antitoxin
-	143629..143690	-	62	NuclAT_0	-	Antitoxin
-	143629..143690	-	62	NuclAT_0	-	Antitoxin
HZR24_RS23580	143677..143883	+	207	WP_015387399.1	type I toxin-antitoxin system Hok family toxin	Toxin
HZR24_RS23585	144167..144424	+	258	WP_000083833.1	replication regulatory protein RepA	-
HZR24_RS23590	144660..144734	+	75	WP_001365705.1	RepA leader peptide Tap	-
HZR24_RS23595	144727..145173	+	447	Protein_160	incFII family plasmid replication initiator RepA	-
HZR24_RS23600	145119..145601	-	483	Protein_161	VENN motif pre-toxin domain-containing protein	-
HZR24_RS23605	146494..147714	+	1221	WP_000410951.1	arginine deiminase	-
HZR24_RS23610	147725..148636	+	912	WP_000440183.1	carbamate kinase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	tet(A) / qnrS1 / dfrA14 / blaTEM-1B / sitABCD	iucA / iucB / iucC / iucD / iutA	1..154098	154098
	-	flank	IS/Tn	-	-	142510..143013	503

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7720.23 Da
• Isoelectric Point: 9.3127

>T167019 WP_015387399.1 NZ_CP058653:143677-143883 [Escherichia coli]
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T167019 NZ_CP074592:1868523-1868626 [Salmonella bongori serovar 40:z35:-]
GGCAGGGCGACTTAACCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 62 bp

>AT167019 NZ_CP058653:c143690-143629 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin