Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 436741..437258 | Replicon | chromosome |
Accession | NZ_CP058613 | ||
Organism | Staphylococcus aureus strain 128254 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | T1YC79 |
Locus tag | HZR13_RS02070 | Protein ID | WP_000113262.1 |
Coordinates | 436992..437258 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | T1YB60 |
Locus tag | HZR13_RS02065 | Protein ID | WP_000584499.1 |
Coordinates | 436741..436992 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZR13_RS02030 | 432207..432419 | + | 213 | Protein_403 | cystatin-like fold lipoprotein | - |
HZR13_RS02035 | 432469..433143 | - | 675 | WP_031919200.1 | IS6-like element IS257 family transposase | - |
HZR13_RS02040 | 433911..434468 | + | 558 | WP_048665604.1 | hypothetical protein | - |
HZR13_RS02045 | 434952..435626 | - | 675 | WP_001105987.1 | IS6-like element IS257 family transposase | - |
HZR13_RS02050 | 435674..435850 | + | 177 | Protein_407 | cystatin-like fold lipoprotein | - |
HZR13_RS02055 | 435869..436468 | + | 600 | WP_000162813.1 | DsbA family protein | - |
HZR13_RS02060 | 436475..436576 | + | 102 | WP_001791744.1 | hypothetical protein | - |
HZR13_RS02065 | 436741..436992 | + | 252 | WP_000584499.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
HZR13_RS02070 | 436992..437258 | + | 267 | WP_000113262.1 | Txe/YoeB family addiction module toxin | Toxin |
HZR13_RS02075 | 437293..437364 | + | 72 | Protein_412 | hypothetical protein | - |
HZR13_RS02080 | 437553..439103 | + | 1551 | WP_000727762.1 | zinc ABC transporter substrate-binding lipoprotein AdcA | - |
HZR13_RS02085 | 439289..439756 | + | 468 | WP_000153344.1 | SRPBCC domain-containing protein | - |
HZR13_RS02090 | 439840..440022 | + | 183 | WP_000230294.1 | hypothetical protein | - |
HZR13_RS02095 | 440239..441063 | + | 825 | WP_000572040.1 | formate/nitrite transporter family protein | - |
HZR13_RS02100 | 441296..441832 | + | 537 | WP_000169317.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10437.95 Da Isoelectric Point: 9.9143
>T166910 WP_000113262.1 NZ_CP058613:436992-437258 [Staphylococcus aureus]
MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY
MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY
Download Length: 267 bp
>T166910 NZ_CP074545:2081206-2081236 [Klebsiella aerogenes]
CGAATACAGGAATCGTGTTCGGTCTCTTTTT
CGAATACAGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 84 a.a. Molecular weight: 9433.60 Da Isoelectric Point: 4.3407
>AT166910 WP_000584499.1 NZ_CP058613:436741-436992 [Staphylococcus aureus]
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKD
IDV
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKD
IDV
Download Length: 252 bp
>AT166910 NZ_CP074545:c2081244-2081206 [Klebsiella aerogenes]
TAATAGATAAAAAGAGACCGAACACGATTCCTGTATTCG
TAATAGATAAAAAGAGACCGAACACGATTCCTGTATTCG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|