Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 13073..13337 | Replicon | plasmid pEC2-1 |
| Accession | NZ_CP058572 | ||
| Organism | Escherichia coli strain EC2 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | HX136_RS25105 | Protein ID | WP_001331364.1 |
| Coordinates | 13073..13225 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 13280..13337 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HX136_RS25080 | 8350..10518 | + | 2169 | WP_021537350.1 | DotA/TraY family protein | - |
| HX136_RS25085 | 10592..11242 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| HX136_RS25090 | 11314..11523 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| HX136_RS25095 | 11915..12091 | + | 177 | WP_001054904.1 | hypothetical protein | - |
| HX136_RS25100 | 12750..13001 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| HX136_RS25105 | 13073..13225 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - | 13280..13337 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 13280..13337 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 13280..13337 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 13280..13337 | + | 58 | NuclAT_0 | - | Antitoxin |
| HX136_RS25110 | 13517..14725 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| HX136_RS25115 | 14744..15814 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| HX136_RS25120 | 15807..18098 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / sul3 / fosA3 / blaTEM-1B | - | 1..109494 | 109494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T166829 WP_001331364.1 NZ_CP058572:c13225-13073 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T166829 NZ_CP074519:1850598-1850700 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT166829 NZ_CP058572:13280-13337 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|