Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2337251..2337468 | Replicon | chromosome |
| Accession | NZ_CP058312 | ||
| Organism | Staphylococcus aureus strain BLR-DV | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | HW113_RS11750 | Protein ID | WP_001802298.1 |
| Coordinates | 2337364..2337468 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2337251..2337306 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW113_RS11730 | 2333388..2334053 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| HW113_RS11735 | 2334205..2334525 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| HW113_RS11740 | 2334527..2335507 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| HW113_RS11745 | 2335773..2336864 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2337251..2337306 | + | 56 | - | - | Antitoxin |
| HW113_RS11750 | 2337364..2337468 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| HW113_RS11755 | 2337629..2338112 | - | 484 | Protein_2279 | recombinase family protein | - |
| HW113_RS11760 | 2338155..2339291 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| HW113_RS11765 | 2339580..2339672 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| HW113_RS11770 | 2339919..2341091 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2339919..2341091 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T166534 WP_001802298.1 NZ_CP058312:c2337468-2337364 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T166534 NZ_CP074347:2008579-2008675 [Serratia entomophila]
AACAAGCCCTGCATTAAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATC
GTATTCGGTCTTTTTTT
AACAAGCCCTGCATTAAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATC
GTATTCGGTCTTTTTTT
Antitoxin
Download Length: 56 bp
>AT166534 NZ_CP058312:2337251-2337306 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|