Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2753821..2754041 Replicon chromosome
Accession NZ_CP058308
Organism Escherichia coli strain AMSCJX04

Toxin (Protein)


Gene name ldrD Uniprot ID A0A8S7XT81
Locus tag HXS78_RS13265 Protein ID WP_074147554.1
Coordinates 2753934..2754041 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2753821..2753887 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HXS78_RS13240 2749100..2750494 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
HXS78_RS13245 2750679..2751032 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HXS78_RS13250 2751076..2751771 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
HXS78_RS13255 2751929..2752159 - 231 WP_001146442.1 putative cation transport regulator ChaB -
HXS78_RS13260 2752429..2753529 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2753821..2753887 - 67 - - Antitoxin
HXS78_RS13265 2753934..2754041 + 108 WP_074147554.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2754354..2754417 - 64 NuclAT_35 - -
- 2754354..2754417 - 64 NuclAT_35 - -
- 2754354..2754417 - 64 NuclAT_35 - -
- 2754354..2754417 - 64 NuclAT_35 - -
- 2754354..2754417 - 64 NuclAT_38 - -
- 2754354..2754417 - 64 NuclAT_38 - -
- 2754354..2754417 - 64 NuclAT_38 - -
- 2754354..2754417 - 64 NuclAT_38 - -
- 2754354..2754417 - 64 NuclAT_41 - -
- 2754354..2754417 - 64 NuclAT_41 - -
- 2754354..2754417 - 64 NuclAT_41 - -
- 2754354..2754417 - 64 NuclAT_41 - -
- 2754354..2754417 - 64 NuclAT_44 - -
- 2754354..2754417 - 64 NuclAT_44 - -
- 2754354..2754417 - 64 NuclAT_44 - -
- 2754354..2754417 - 64 NuclAT_44 - -
- 2754354..2754417 - 64 NuclAT_47 - -
- 2754354..2754417 - 64 NuclAT_47 - -
- 2754354..2754417 - 64 NuclAT_47 - -
- 2754354..2754417 - 64 NuclAT_47 - -
- 2754354..2754417 - 64 NuclAT_50 - -
- 2754354..2754417 - 64 NuclAT_50 - -
- 2754354..2754417 - 64 NuclAT_50 - -
- 2754354..2754417 - 64 NuclAT_50 - -
- 2754355..2754417 - 63 NuclAT_52 - -
- 2754355..2754417 - 63 NuclAT_52 - -
- 2754355..2754417 - 63 NuclAT_52 - -
- 2754355..2754417 - 63 NuclAT_52 - -
- 2754355..2754417 - 63 NuclAT_55 - -
- 2754355..2754417 - 63 NuclAT_55 - -
- 2754355..2754417 - 63 NuclAT_55 - -
- 2754355..2754417 - 63 NuclAT_55 - -
- 2754356..2754417 - 62 NuclAT_17 - -
- 2754356..2754417 - 62 NuclAT_17 - -
- 2754356..2754417 - 62 NuclAT_17 - -
- 2754356..2754417 - 62 NuclAT_17 - -
- 2754356..2754417 - 62 NuclAT_20 - -
- 2754356..2754417 - 62 NuclAT_20 - -
- 2754356..2754417 - 62 NuclAT_20 - -
- 2754356..2754417 - 62 NuclAT_20 - -
- 2754356..2754417 - 62 NuclAT_23 - -
- 2754356..2754417 - 62 NuclAT_23 - -
- 2754356..2754417 - 62 NuclAT_23 - -
- 2754356..2754417 - 62 NuclAT_23 - -
- 2754356..2754417 - 62 NuclAT_26 - -
- 2754356..2754417 - 62 NuclAT_26 - -
- 2754356..2754417 - 62 NuclAT_26 - -
- 2754356..2754417 - 62 NuclAT_26 - -
- 2754356..2754417 - 62 NuclAT_29 - -
- 2754356..2754417 - 62 NuclAT_29 - -
- 2754356..2754417 - 62 NuclAT_29 - -
- 2754356..2754417 - 62 NuclAT_29 - -
- 2754356..2754417 - 62 NuclAT_32 - -
- 2754356..2754417 - 62 NuclAT_32 - -
- 2754356..2754417 - 62 NuclAT_32 - -
- 2754356..2754417 - 62 NuclAT_32 - -
HXS78_RS13270 2754470..2754577 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2754890..2754955 - 66 NuclAT_34 - -
- 2754890..2754955 - 66 NuclAT_34 - -
- 2754890..2754955 - 66 NuclAT_34 - -
- 2754890..2754955 - 66 NuclAT_34 - -
- 2754890..2754955 - 66 NuclAT_37 - -
- 2754890..2754955 - 66 NuclAT_37 - -
- 2754890..2754955 - 66 NuclAT_37 - -
- 2754890..2754955 - 66 NuclAT_37 - -
- 2754890..2754955 - 66 NuclAT_40 - -
- 2754890..2754955 - 66 NuclAT_40 - -
- 2754890..2754955 - 66 NuclAT_40 - -
- 2754890..2754955 - 66 NuclAT_40 - -
- 2754890..2754955 - 66 NuclAT_43 - -
- 2754890..2754955 - 66 NuclAT_43 - -
- 2754890..2754955 - 66 NuclAT_43 - -
- 2754890..2754955 - 66 NuclAT_43 - -
- 2754890..2754955 - 66 NuclAT_46 - -
- 2754890..2754955 - 66 NuclAT_46 - -
- 2754890..2754955 - 66 NuclAT_46 - -
- 2754890..2754955 - 66 NuclAT_46 - -
- 2754890..2754955 - 66 NuclAT_49 - -
- 2754890..2754955 - 66 NuclAT_49 - -
- 2754890..2754955 - 66 NuclAT_49 - -
- 2754890..2754955 - 66 NuclAT_49 - -
- 2754891..2754957 - 67 NuclAT_51 - -
- 2754891..2754957 - 67 NuclAT_51 - -
- 2754891..2754957 - 67 NuclAT_51 - -
- 2754891..2754957 - 67 NuclAT_51 - -
- 2754891..2754957 - 67 NuclAT_54 - -
- 2754891..2754957 - 67 NuclAT_54 - -
- 2754891..2754957 - 67 NuclAT_54 - -
- 2754891..2754957 - 67 NuclAT_54 - -
- 2754892..2754955 - 64 NuclAT_16 - -
- 2754892..2754955 - 64 NuclAT_16 - -
- 2754892..2754955 - 64 NuclAT_16 - -
- 2754892..2754955 - 64 NuclAT_16 - -
- 2754892..2754955 - 64 NuclAT_19 - -
- 2754892..2754955 - 64 NuclAT_19 - -
- 2754892..2754955 - 64 NuclAT_19 - -
- 2754892..2754955 - 64 NuclAT_19 - -
- 2754892..2754955 - 64 NuclAT_22 - -
- 2754892..2754955 - 64 NuclAT_22 - -
- 2754892..2754955 - 64 NuclAT_22 - -
- 2754892..2754955 - 64 NuclAT_22 - -
- 2754892..2754955 - 64 NuclAT_25 - -
- 2754892..2754955 - 64 NuclAT_25 - -
- 2754892..2754955 - 64 NuclAT_25 - -
- 2754892..2754955 - 64 NuclAT_25 - -
- 2754892..2754955 - 64 NuclAT_28 - -
- 2754892..2754955 - 64 NuclAT_28 - -
- 2754892..2754955 - 64 NuclAT_28 - -
- 2754892..2754955 - 64 NuclAT_28 - -
- 2754892..2754955 - 64 NuclAT_31 - -
- 2754892..2754955 - 64 NuclAT_31 - -
- 2754892..2754955 - 64 NuclAT_31 - -
- 2754892..2754955 - 64 NuclAT_31 - -
HXS78_RS13275 2755005..2755112 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
HXS78_RS13280 2755261..2756115 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HXS78_RS13285 2756151..2756960 - 810 WP_001257044.1 invasion regulator SirB1 -
HXS78_RS13290 2756964..2757356 - 393 WP_000200378.1 invasion regulator SirB2 -
HXS78_RS13295 2757353..2758186 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T166504 WP_074147554.1 NZ_CP058308:2753934-2754041 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Download         Length: 108 bp

>T166504 NZ_CP074180:497-787 [Enterobacter asburiae]
ATGCCATCGTTAAGCTGGACACCACAGGCGCTGGCCGACGTTCAGCGCCTGTATCGTTTTCTGGCTCCCCGGGATCTGAA
TGCAGCCCGTAACGCCATCACTGAGATTCGAAACAGCGTCAAAATACTGGCGTATCAGCCTGAGTCCGGACGACCGATAG
AAGAATCGCCATCCTACCGGGAATGGCCGATAAGCTTCGGTAACAGTGGCTATGTGGCGCTTTACCGTATTGAAGATGAC
GCCGTGACCATCCTTGCAGTTCGTCATCAGCGGGAAGCCGACTGGTCGTAA

Antitoxin


Download         Length: 67 bp

>AT166504 NZ_CP058308:c2753887-2753821 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References