Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 107595..107864 | Replicon | plasmid pKPCZA02_2 |
| Accession | NZ_CP058228 | ||
| Organism | Klebsiella pneumoniae strain KPCZA02 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | HWQ20_RS27300 | Protein ID | WP_001372321.1 |
| Coordinates | 107739..107864 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 107595..107660 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HWQ20_RS27275 | 103305..103832 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| HWQ20_RS27280 | 103890..104123 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| HWQ20_RS27285 | 104184..106207 | + | 2024 | Protein_142 | ParB/RepB/Spo0J family partition protein | - |
| HWQ20_RS27290 | 106276..106710 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| HWQ20_RS27295 | 106707..107426 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 107438..107662 | + | 225 | NuclAT_0 | - | - |
| - | 107438..107662 | + | 225 | NuclAT_0 | - | - |
| - | 107438..107662 | + | 225 | NuclAT_0 | - | - |
| - | 107438..107662 | + | 225 | NuclAT_0 | - | - |
| - | 107595..107660 | - | 66 | - | - | Antitoxin |
| HWQ20_RS28420 | 107648..107797 | + | 150 | Protein_145 | plasmid maintenance protein Mok | - |
| HWQ20_RS27300 | 107739..107864 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HWQ20_RS27305 | 108183..108479 | - | 297 | Protein_147 | hypothetical protein | - |
| HWQ20_RS27310 | 108779..109075 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| HWQ20_RS27315 | 109186..110007 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| HWQ20_RS27320 | 110304..110951 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| HWQ20_RS27325 | 111228..111611 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HWQ20_RS27330 | 111802..112488 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| HWQ20_RS27335 | 112582..112809 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | - | 1..149200 | 149200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T166308 WP_001372321.1 NZ_CP058228:107739-107864 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T166308 NZ_CP074120:c749171-748995 [Escherichia coli]
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATAGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATAGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
Antitoxin
Download Length: 66 bp
>AT166308 NZ_CP058228:c107660-107595 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|