Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 33504..33757 | Replicon | plasmid pRHB24-C12_3 |
Accession | NZ_CP058211 | ||
Organism | Escherichia marmotae strain RHB24-C12 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | HVY12_RS23735 | Protein ID | WP_001312851.1 |
Coordinates | 33504..33653 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 33698..33757 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVY12_RS23710 | 28995..29102 | + | 108 | WP_157924485.1 | hypothetical protein | - |
HVY12_RS23720 | 31812..32669 | - | 858 | WP_137585087.1 | incFII family plasmid replication initiator RepA | - |
HVY12_RS23725 | 32662..32736 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
HVY12_RS23730 | 32960..33220 | - | 261 | WP_000083819.1 | replication regulatory protein RepA | - |
HVY12_RS23735 | 33504..33653 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 33698..33757 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 33698..33757 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 33698..33757 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 33698..33757 | + | 60 | NuclAT_0 | - | Antitoxin |
HVY12_RS23740 | 34301..34531 | - | 231 | WP_181238297.1 | hypothetical protein | - |
HVY12_RS23745 | 34700..35299 | - | 600 | WP_181238298.1 | hypothetical protein | - |
HVY12_RS23750 | 35671..35865 | + | 195 | WP_024234536.1 | hypothetical protein | - |
HVY12_RS23755 | 36019..36579 | - | 561 | WP_000139377.1 | fertility inhibition protein FinO | - |
HVY12_RS23760 | 36653..37402 | - | 750 | WP_181238299.1 | type-F conjugative transfer system pilin acetylase TraX | - |
HVY12_RS23765 | 37410..37631 | - | 222 | WP_181238300.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..95282 | 95282 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T166151 WP_001312851.1 NZ_CP058211:c33653-33504 [Escherichia marmotae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T166151 NZ_CP074047:2609512-2609619 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT166151 NZ_CP058211:33698-33757 [Escherichia marmotae]
AACGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
AACGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|